Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6712
Gene name
LocationContig_76:15698..17709
Strand+
Gene length (bp)2011
Transcript length (bp)1740
Coding sequence length (bp)1740
Protein length (aa) 580

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06418 CTP_synth_N CTP synthase N-terminus 9.7E-119 2 268
PF00117 GATase Glutamine amidotransferase class-I 1.6E-56 313 550
PF07722 Peptidase_C26 Peptidase C26 6.6E-06 391 533

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZV2|PYRG_NEUCR CTP synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-7 PE=3 SV=2 18 579 0.0E+00
sp|O74638|PYRG_GIBZE CTP synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=URA7 PE=3 SV=2 1 579 0.0E+00
sp|P28274|URA7_YEAST CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA7 PE=1 SV=2 1 559 0.0E+00
sp|Q6FUD0|PYRG_CANGA CTP synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA7 PE=3 SV=1 1 574 0.0E+00
sp|P38627|URA8_YEAST CTP synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA8 PE=1 SV=4 1 569 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q7RZV2|PYRG_NEUCR CTP synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pyr-7 PE=3 SV=2 18 579 0.0E+00
sp|O74638|PYRG_GIBZE CTP synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=URA7 PE=3 SV=2 1 579 0.0E+00
sp|P28274|URA7_YEAST CTP synthase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA7 PE=1 SV=2 1 559 0.0E+00
sp|Q6FUD0|PYRG_CANGA CTP synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=URA7 PE=3 SV=1 1 574 0.0E+00
sp|P38627|URA8_YEAST CTP synthase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=URA8 PE=1 SV=4 1 569 0.0E+00
sp|A6ZQ59|URA8_YEAS7 CTP synthase 2 OS=Saccharomyces cerevisiae (strain YJM789) GN=URA8 PE=3 SV=1 1 569 0.0E+00
sp|Q751L7|PYRG_ASHGO CTP synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=URA7 PE=3 SV=1 1 556 0.0E+00
sp|O42644|PYRG_SCHPO CTP synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ura7 PE=3 SV=1 1 556 0.0E+00
sp|Q5XHA8|PYG1A_XENLA CTP synthase 1-A OS=Xenopus laevis GN=ctps1-a PE=2 SV=1 1 556 0.0E+00
sp|P70698|PYRG1_MOUSE CTP synthase 1 OS=Mus musculus GN=Ctps1 PE=1 SV=2 1 577 0.0E+00
sp|Q6GME1|PYRG2_XENLA CTP synthase 2 OS=Xenopus laevis GN=ctps2 PE=2 SV=1 1 562 0.0E+00
sp|Q7ZXP9|PYG1B_XENLA CTP synthase 1-B OS=Xenopus laevis GN=ctps1-b PE=2 SV=1 1 556 0.0E+00
sp|P17812|PYRG1_HUMAN CTP synthase 1 OS=Homo sapiens GN=CTPS1 PE=1 SV=2 1 577 0.0E+00
sp|Q6PEI7|PYRG1_DANRE CTP synthase 1 OS=Danio rerio GN=ctps1 PE=1 SV=1 1 557 0.0E+00
sp|Q1RMS2|PYRG2_BOVIN CTP synthase 2 OS=Bos taurus GN=CTPS2 PE=2 SV=1 1 557 0.0E+00
sp|Q5U2N0|PYRG2_RAT CTP synthase 2 OS=Rattus norvegicus GN=Ctps2 PE=1 SV=1 1 569 0.0E+00
sp|Q9NRF8|PYRG2_HUMAN CTP synthase 2 OS=Homo sapiens GN=CTPS2 PE=1 SV=1 1 557 0.0E+00
sp|P70303|PYRG2_MOUSE CTP synthase 2 OS=Mus musculus GN=Ctps2 PE=1 SV=1 1 557 0.0E+00
sp|Q5F3Z1|PYRG2_CHICK CTP synthase 2 OS=Gallus gallus GN=CTPS2 PE=2 SV=1 1 557 0.0E+00
sp|Q54V77|PYRG_DICDI CTP synthase OS=Dictyostelium discoideum GN=ctps PE=3 SV=1 1 561 0.0E+00
sp|Q9VUL1|PYRG_DROME CTP synthase OS=Drosophila melanogaster GN=CTPsyn PE=1 SV=2 1 558 0.0E+00
sp|Q2M197|PYRG_DROPS CTP synthase OS=Drosophila pseudoobscura pseudoobscura GN=CTPsyn PE=3 SV=2 1 552 0.0E+00
sp|Q3IS15|PYRG_NATPD CTP synthase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=pyrG PE=3 SV=1 2 549 2.0E-178
sp|Q8TYT7|PYRG_METKA CTP synthase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=pyrG PE=3 SV=1 1 554 3.0E-177
sp|Q9HP32|PYRG_HALSA CTP synthase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=pyrG PE=3 SV=1 2 551 2.0E-174
sp|B0R6G2|PYRG_HALS3 CTP synthase OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=pyrG PE=3 SV=1 2 551 2.0E-174
sp|O29987|PYRG_ARCFU CTP synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=pyrG PE=3 SV=1 1 552 7.0E-173
sp|Q3AFT7|PYRG_CARHZ CTP synthase OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=pyrG PE=3 SV=1 2 548 4.0E-171
sp|A2SSJ7|PYRG_METLZ CTP synthase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=pyrG PE=3 SV=1 1 551 4.0E-170
sp|Q6L1K7|PYRG_PICTO CTP synthase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=pyrG PE=3 SV=1 1 552 1.0E-169
sp|Q18FG3|PYRG_HALWD CTP synthase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=pyrG PE=3 SV=1 2 556 2.0E-169
sp|Q12WH5|PYRG_METBU CTP synthase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=pyrG PE=3 SV=1 1 551 4.0E-169
sp|A3CWS5|PYRG_METMJ CTP synthase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=pyrG PE=3 SV=1 1 551 4.0E-169
sp|A0B7H6|PYRG_METTP CTP synthase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=pyrG PE=3 SV=1 1 551 7.0E-169
sp|Q5UX57|PYRG_HALMA CTP synthase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=pyrG PE=3 SV=1 2 554 5.0E-168
sp|A7IA93|PYRG_METB6 CTP synthase OS=Methanoregula boonei (strain 6A8) GN=pyrG PE=3 SV=1 1 551 9.0E-168
sp|Q1AW18|PYRG_RUBXD CTP synthase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=pyrG PE=3 SV=1 2 555 7.0E-167
sp|Q6LYU4|PYRG_METMP CTP synthase OS=Methanococcus maripaludis (strain S2 / LL) GN=pyrG PE=3 SV=1 1 552 1.0E-166
sp|Q2RFU8|PYRG_MOOTA CTP synthase OS=Moorella thermoacetica (strain ATCC 39073) GN=pyrG PE=3 SV=1 2 552 3.0E-166
sp|B8GIB3|PYRG_METPE CTP synthase OS=Methanosphaerula palustris (strain ATCC BAA-1556 / DSM 19958 / E1-9c) GN=pyrG PE=3 SV=1 1 551 9.0E-166
sp|P50547|PYRG1_CRIGR CTP synthase 1 (Fragment) OS=Cricetulus griseus GN=CTPS1 PE=2 SV=1 40 491 3.0E-165
sp|Q8DKT7|PYRG_THEEB CTP synthase OS=Thermosynechococcus elongatus (strain BP-1) GN=pyrG PE=3 SV=1 2 558 6.0E-164
sp|Q9RU23|PYRG_DEIRA CTP synthase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=pyrG PE=3 SV=1 1 552 2.0E-163
sp|C5A7F1|PYRG_THEGJ CTP synthase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=pyrG PE=3 SV=1 2 552 3.0E-163
sp|Q67TG8|PYRG_SYMTH CTP synthase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=pyrG PE=3 SV=1 2 552 3.0E-162
sp|B9LB79|PYRG_CHLSY CTP synthase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=pyrG PE=3 SV=1 2 556 5.0E-162
sp|A9WJ75|PYRG_CHLAA CTP synthase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=pyrG PE=3 SV=1 2 556 5.0E-162
sp|Q5JGF1|PYRG_THEKO CTP synthase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=pyrG PE=3 SV=1 2 552 8.0E-162
sp|A6UTE4|PYRG_META3 CTP synthase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=pyrG PE=3 SV=1 1 552 8.0E-162
sp|C1CWM4|PYRG_DEIDV CTP synthase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=pyrG PE=3 SV=1 1 552 2.0E-161
sp|Q2FSE6|PYRG_METHJ CTP synthase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=pyrG PE=3 SV=1 1 552 2.0E-161
sp|B6YTF0|PYRG_THEON CTP synthase OS=Thermococcus onnurineus (strain NA1) GN=pyrG PE=3 SV=1 2 552 2.0E-161
sp|B0CBC7|PYRG_ACAM1 CTP synthase OS=Acaryochloris marina (strain MBIC 11017) GN=pyrG PE=3 SV=1 2 556 3.0E-161
sp|C1F1E7|PYRG_ACIC5 CTP synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) GN=pyrG PE=3 SV=1 2 552 4.0E-161
sp|B7JVR6|PYRG_CYAP8 CTP synthase OS=Cyanothece sp. (strain PCC 8801) GN=pyrG PE=3 SV=1 2 552 8.0E-161
sp|Q1WV30|PYRG_LACS1 CTP synthase OS=Lactobacillus salivarius (strain UCC118) GN=pyrG PE=3 SV=1 2 554 1.0E-160
sp|Q5N040|PYRG_SYNP6 CTP synthase OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=pyrG PE=3 SV=2 2 554 1.0E-160
sp|C4LBR2|PYRG_TOLAT CTP synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=pyrG PE=3 SV=1 2 558 3.0E-160
sp|Q1IKC9|PYRG_KORVE CTP synthase OS=Koribacter versatilis (strain Ellin345) GN=pyrG PE=3 SV=1 2 552 4.0E-160
sp|B9L7R9|PYRG_NAUPA CTP synthase OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=pyrG PE=3 SV=1 2 555 6.0E-160
sp|Q1J055|PYRG_DEIGD CTP synthase OS=Deinococcus geothermalis (strain DSM 11300) GN=pyrG PE=3 SV=1 1 552 6.0E-160
sp|A3DGR3|PYRG_CLOTH CTP synthase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=pyrG PE=3 SV=1 1 553 1.0E-159
sp|Q2JUH1|PYRG_SYNJA CTP synthase OS=Synechococcus sp. (strain JA-3-3Ab) GN=pyrG PE=3 SV=1 2 552 3.0E-159
sp|Q65DT7|PYRG_BACLD CTP synthase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=pyrG PE=3 SV=1 2 552 3.0E-159
sp|Q8YMD4|PYRG_NOSS1 CTP synthase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=pyrG PE=3 SV=1 2 557 4.0E-159
sp|Q3MAV1|PYRG_ANAVT CTP synthase OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=pyrG PE=3 SV=1 2 557 4.0E-159
sp|Q54775|PYRG_SYNE7 CTP synthase OS=Synechococcus elongatus (strain PCC 7942) GN=pyrG PE=3 SV=1 2 554 7.0E-159
sp|Q24MK9|PYRG_DESHY CTP synthase OS=Desulfitobacterium hafniense (strain Y51) GN=pyrG PE=3 SV=1 2 552 7.0E-159
sp|B5Y8A3|PYRG_COPPD CTP synthase OS=Coprothermobacter proteolyticus (strain ATCC 35245 / DSM 5265 / BT) GN=pyrG PE=3 SV=1 2 554 8.0E-159
sp|B8GAQ5|PYRG_CHLAD CTP synthase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=pyrG PE=3 SV=1 2 556 9.0E-159
sp|Q2LRK2|PYRG_SYNAS CTP synthase OS=Syntrophus aciditrophicus (strain SB) GN=pyrG PE=3 SV=1 2 552 1.0E-158
sp|Q8TZY6|PYRG_PYRFU CTP synthase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=pyrG PE=3 SV=2 2 552 1.0E-158
sp|Q58574|PYRG_METJA CTP synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=pyrG PE=3 SV=1 1 554 3.0E-158
sp|Q927T4|PYRG_LISIN CTP synthase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=pyrG PE=3 SV=1 2 552 3.0E-158
sp|Q8R720|PYRG_CALS4 CTP synthase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=pyrG PE=3 SV=1 2 551 3.0E-158
sp|Q71WM0|PYRG_LISMF CTP synthase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=pyrG PE=3 SV=1 2 552 5.0E-158
sp|B1WV74|PYRG_CYAA5 CTP synthase OS=Cyanothece sp. (strain ATCC 51142) GN=pyrG PE=3 SV=1 2 552 6.0E-158
sp|B1XMC5|PYRG_SYNP2 CTP synthase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=pyrG PE=3 SV=1 2 554 6.0E-158
sp|A5GWT6|PYRG_SYNR3 CTP synthase OS=Synechococcus sp. (strain RCC307) GN=pyrG PE=3 SV=1 2 553 6.0E-158
sp|Q8EM53|PYRG_OCEIH CTP synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=pyrG PE=3 SV=1 2 552 7.0E-158
sp|Q5KUG2|PYRG_GEOKA CTP synthase OS=Geobacillus kaustophilus (strain HTA426) GN=pyrG PE=3 SV=1 2 552 7.0E-158
sp|Q9HM27|PYRG_THEAC CTP synthase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=pyrG PE=3 SV=2 1 558 9.0E-158
sp|Q2SKX2|PYRG_HAHCH CTP synthase OS=Hahella chejuensis (strain KCTC 2396) GN=pyrG PE=3 SV=1 2 552 9.0E-158
sp|B7KF08|PYRG_CYAP7 CTP synthase OS=Cyanothece sp. (strain PCC 7424) GN=pyrG PE=3 SV=1 2 557 2.0E-157
sp|O59456|PYRG_PYRHO CTP synthase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=pyrG PE=3 SV=2 2 552 3.0E-157
sp|Q72IN0|PYRG_THET2 CTP synthase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=pyrG PE=3 SV=1 2 558 4.0E-157
sp|Q5SIA8|PYRG_THET8 CTP synthase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=pyrG PE=1 SV=1 2 558 4.0E-157
sp|A5UXX5|PYRG_ROSS1 CTP synthase OS=Roseiflexus sp. (strain RS-1) GN=pyrG PE=3 SV=1 2 553 4.0E-157
sp|A3CQB0|PYRG_STRSV CTP synthase OS=Streptococcus sanguinis (strain SK36) GN=pyrG PE=3 SV=1 2 552 5.0E-157
sp|Q8Y495|PYRG_LISMO CTP synthase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=pyrG PE=3 SV=1 2 552 8.0E-157
sp|C1DSS8|PYRG_AZOVD CTP synthase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=pyrG PE=3 SV=1 2 552 1.0E-156
sp|Q5WB43|PYRG_BACSK CTP synthase OS=Bacillus clausii (strain KSM-K16) GN=pyrG PE=3 SV=1 2 552 1.0E-156
sp|Q086B1|PYRG_SHEFN CTP synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=pyrG PE=3 SV=1 2 552 2.0E-156
sp|A7NN90|PYRG_ROSCS CTP synthase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=pyrG PE=3 SV=1 2 553 2.0E-156
sp|A8FIE5|PYRG_BACP2 CTP synthase OS=Bacillus pumilus (strain SAFR-032) GN=pyrG PE=3 SV=1 2 552 2.0E-156
sp|Q836G5|PYRG_ENTFA CTP synthase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=pyrG PE=3 SV=1 2 552 3.0E-156
sp|A5CYA0|PYRG_PELTS CTP synthase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=pyrG PE=3 SV=1 2 552 4.0E-156
sp|B1JBP2|PYRG_PSEPW CTP synthase OS=Pseudomonas putida (strain W619) GN=pyrG PE=3 SV=1 2 552 4.0E-156
sp|Q9V1S2|PYRG_PYRAB CTP synthase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=pyrG PE=3 SV=1 2 552 4.0E-156
sp|A7GV88|PYRG_BACCN CTP synthase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=pyrG PE=3 SV=1 2 552 4.0E-156
sp|A8AZ08|PYRG_STRGC CTP synthase OS=Streptococcus gordonii (strain Challis / ATCC 35105 / CH1 / DL1 / V288) GN=pyrG PE=3 SV=1 2 552 7.0E-156
sp|P13242|PYRG_BACSU CTP synthase OS=Bacillus subtilis (strain 168) GN=pyrG PE=3 SV=1 2 552 9.0E-156
sp|Q0AU97|PYRG_SYNWW CTP synthase OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=pyrG PE=3 SV=1 2 556 1.0E-155
sp|A6LQF6|PYRG_CLOB8 CTP synthase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=pyrG PE=3 SV=1 2 552 1.0E-155
sp|Q5M6C0|PYRG_STRT2 CTP synthase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=pyrG PE=3 SV=1 2 552 1.0E-155
sp|Q81JW1|PYRG_BACAN CTP synthase OS=Bacillus anthracis GN=pyrG PE=3 SV=1 2 552 1.0E-155
sp|C3LFL2|PYRG_BACAC CTP synthase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=pyrG PE=3 SV=1 2 552 1.0E-155
sp|C3P2A0|PYRG_BACAA CTP synthase OS=Bacillus anthracis (strain A0248) GN=pyrG PE=3 SV=1 2 552 1.0E-155
sp|Q0SQX5|PYRG_CLOPS CTP synthase OS=Clostridium perfringens (strain SM101 / Type A) GN=pyrG PE=3 SV=1 2 552 1.0E-155
sp|Q8XIB3|PYRG_CLOPE CTP synthase OS=Clostridium perfringens (strain 13 / Type A) GN=pyrG PE=3 SV=1 2 552 1.0E-155
sp|Q0TNA4|PYRG_CLOP1 CTP synthase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=pyrG PE=3 SV=1 2 552 1.0E-155
sp|Q9K6D7|PYRG_BACHD CTP synthase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=pyrG PE=3 SV=1 2 552 2.0E-155
sp|Q630R0|PYRG_BACCZ CTP synthase OS=Bacillus cereus (strain ZK / E33L) GN=pyrG PE=3 SV=1 2 552 2.0E-155
sp|B7JHG1|PYRG_BACC0 CTP synthase OS=Bacillus cereus (strain AH820) GN=pyrG PE=3 SV=1 2 552 2.0E-155
sp|C0M8K6|PYRG_STRE4 CTP synthase OS=Streptococcus equi subsp. equi (strain 4047) GN=pyrG PE=3 SV=1 2 552 2.0E-155
sp|A9VSD6|PYRG_BACWK CTP synthase OS=Bacillus weihenstephanensis (strain KBAB4) GN=pyrG PE=3 SV=1 2 552 3.0E-155
sp|Q7NKF4|PYRG_GLOVI CTP synthase OS=Gloeobacter violaceus (strain PCC 7421) GN=pyrG PE=3 SV=1 2 552 3.0E-155
sp|A9B6S7|PYRG_HERA2 CTP synthase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=pyrG PE=3 SV=1 2 552 3.0E-155
sp|Q5M1S7|PYRG_STRT1 CTP synthase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=pyrG PE=3 SV=1 2 552 4.0E-155
sp|Q7V9I0|PYRG_PROMA CTP synthase OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=pyrG PE=3 SV=1 2 552 4.0E-155
sp|Q97F61|PYRG_CLOAB CTP synthase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=pyrG PE=3 SV=1 2 548 5.0E-155
sp|A4XWS3|PYRG_PSEMY CTP synthase OS=Pseudomonas mendocina (strain ymp) GN=pyrG PE=3 SV=1 2 552 7.0E-155
sp|Q6HAU5|PYRG_BACHK CTP synthase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=pyrG PE=3 SV=1 2 552 8.0E-155
sp|C1F0R6|PYRG_BACC3 CTP synthase OS=Bacillus cereus (strain 03BB102) GN=pyrG PE=3 SV=1 2 552 8.0E-155
sp|A0RLC3|PYRG_BACAH CTP synthase OS=Bacillus thuringiensis (strain Al Hakam) GN=pyrG PE=3 SV=1 2 552 8.0E-155
sp|B3R496|PYRG_CUPTR CTP synthase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=pyrG PE=3 SV=1 2 558 8.0E-155
sp|A1S4D6|PYRG_SHEAM CTP synthase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=pyrG PE=3 SV=1 2 552 8.0E-155
sp|B9IRX1|PYRG_BACCQ CTP synthase OS=Bacillus cereus (strain Q1) GN=pyrG PE=3 SV=1 2 552 8.0E-155
sp|B7HY98|PYRG_BACC7 CTP synthase OS=Bacillus cereus (strain AH187) GN=pyrG PE=3 SV=1 2 552 8.0E-155
sp|C0MFQ9|PYRG_STRS7 CTP synthase OS=Streptococcus equi subsp. zooepidemicus (strain H70) GN=pyrG PE=3 SV=1 2 552 1.0E-154
sp|Q31G66|PYRG_THICR CTP synthase OS=Thiomicrospira crunogena (strain XCL-2) GN=pyrG PE=3 SV=1 2 553 1.0E-154
sp|A8FSS7|PYRG_SHESH CTP synthase OS=Shewanella sediminis (strain HAW-EB3) GN=pyrG PE=3 SV=1 2 558 1.0E-154
sp|A4VJT9|PYRG_PSEU5 CTP synthase OS=Pseudomonas stutzeri (strain A1501) GN=pyrG PE=3 SV=1 2 552 1.0E-154
sp|A3MXN2|PYRG_PYRCJ CTP synthase OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=pyrG PE=3 SV=1 2 552 1.0E-154
sp|Q72XB0|PYRG_BACC1 CTP synthase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=pyrG PE=3 SV=1 2 552 1.0E-154
sp|A9BDD9|PYRG_PROM4 CTP synthase OS=Prochlorococcus marinus (strain MIT 9211) GN=pyrG PE=3 SV=1 2 568 1.0E-154
sp|A8FJJ0|PYRG_CAMJ8 CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=pyrG PE=3 SV=1 2 552 2.0E-154
sp|B9MEQ7|PYRG_ACIET CTP synthase OS=Acidovorax ebreus (strain TPSY) GN=pyrG PE=3 SV=1 2 552 2.0E-154
sp|B7IQZ1|PYRG_BACC2 CTP synthase OS=Bacillus cereus (strain G9842) GN=pyrG PE=3 SV=1 2 552 2.0E-154
sp|B8I598|PYRG_CLOCE CTP synthase OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=pyrG PE=3 SV=1 1 552 2.0E-154
sp|A2C5F9|PYRG_PROM1 CTP synthase OS=Prochlorococcus marinus (strain NATL1A) GN=pyrG PE=3 SV=1 2 552 2.0E-154
sp|A7H1B7|PYRG_CAMJD CTP synthase OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=pyrG PE=3 SV=1 2 552 3.0E-154
sp|Q814T2|PYRG_BACCR CTP synthase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=pyrG PE=3 SV=1 2 552 3.0E-154
sp|B8F5Q9|PYRG_HAEPS CTP synthase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=pyrG PE=3 SV=1 2 552 3.0E-154
sp|Q38V48|PYRG_LACSS CTP synthase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=pyrG PE=3 SV=1 2 552 4.0E-154
sp|B9L1H7|PYRG_THERP CTP synthase OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=pyrG PE=3 SV=1 2 550 4.0E-154
sp|C5CSV3|PYRG_VARPS CTP synthase OS=Variovorax paradoxus (strain S110) GN=pyrG PE=3 SV=1 2 552 5.0E-154
sp|Q12PZ5|PYRG_SHEDO CTP synthase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=pyrG PE=3 SV=1 2 559 6.0E-154
sp|Q5HXD1|PYRG_CAMJR CTP synthase OS=Campylobacter jejuni (strain RM1221) GN=pyrG PE=3 SV=1 2 552 7.0E-154
sp|A1VXA6|PYRG_CAMJJ CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=pyrG PE=3 SV=1 2 552 7.0E-154
sp|Q1J4X1|PYRG_STRPF CTP synthase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=pyrG PE=3 SV=1 2 552 8.0E-154
sp|A5FHA4|PYRG_FLAJ1 CTP synthase OS=Flavobacterium johnsoniae (strain ATCC 17061 / DSM 2064 / UW101) GN=pyrG PE=3 SV=1 2 555 9.0E-154
sp|Q8NZF8|PYRG_STRP8 CTP synthase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=pyrG PE=3 SV=1 2 552 9.0E-154
sp|Q03T27|PYRG_LACBA CTP synthase OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=pyrG PE=3 SV=1 2 553 1.0E-153
sp|B7HFN6|PYRG_BACC4 CTP synthase OS=Bacillus cereus (strain B4264) GN=pyrG PE=3 SV=1 2 552 1.0E-153
sp|Q1JF16|PYRG_STRPD CTP synthase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=pyrG PE=3 SV=1 2 552 1.0E-153
sp|Q46I97|PYRG_PROMT CTP synthase OS=Prochlorococcus marinus (strain NATL2A) GN=pyrG PE=3 SV=1 2 552 1.0E-153
sp|P0DD71|PYRG_STRPQ CTP synthase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|Q1JK23|PYRG_STRPC CTP synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|Q1J9X6|PYRG_STRPB CTP synthase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|Q5XA10|PYRG_STRP6 CTP synthase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|P0DD70|PYRG_STRP3 CTP synthase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|P65925|PYRG_STRP1 CTP synthase OS=Streptococcus pyogenes serotype M1 GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|C3K6H4|PYRG_PSEFS CTP synthase OS=Pseudomonas fluorescens (strain SBW25) GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|A3MYK8|PYRG_ACTP2 CTP synthase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|Q9PJ84|PYRG_CAMJE CTP synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=pyrG PE=3 SV=1 2 552 2.0E-153
sp|Q473G7|PYRG_CUPPJ CTP synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=pyrG PE=3 SV=1 2 558 2.0E-153
sp|Q88MG1|PYRG_PSEPK CTP synthase OS=Pseudomonas putida (strain KT2440) GN=pyrG PE=3 SV=1 2 552 3.0E-153
sp|A5W831|PYRG_PSEP1 CTP synthase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=pyrG PE=3 SV=1 2 552 3.0E-153
sp|B0KSB7|PYRG_PSEPG CTP synthase OS=Pseudomonas putida (strain GB-1) GN=pyrG PE=3 SV=1 2 552 3.0E-153
sp|Q6LMT0|PYRG_PHOPR CTP synthase OS=Photobacterium profundum GN=pyrG PE=3 SV=1 3 556 3.0E-153
sp|Q5WXA8|PYRG_LEGPL CTP synthase OS=Legionella pneumophila (strain Lens) GN=pyrG PE=3 SV=1 2 562 3.0E-153
sp|Q1I644|PYRG_PSEE4 CTP synthase OS=Pseudomonas entomophila (strain L48) GN=pyrG PE=3 SV=1 2 552 3.0E-153
sp|Q8E290|PYRG_STRA5 CTP synthase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=pyrG PE=3 SV=1 2 552 3.0E-153
sp|Q48F77|PYRG_PSE14 CTP synthase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=pyrG PE=3 SV=1 2 552 4.0E-153
sp|Q65VZ8|PYRG_MANSM CTP synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=pyrG PE=3 SV=2 2 552 4.0E-153
sp|A5UIK2|PYRG_HAEIG CTP synthase OS=Haemophilus influenzae (strain PittGG) GN=pyrG PE=3 SV=1 2 552 4.0E-153
sp|Q9HXZ4|PYRG_PSEAE CTP synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=pyrG PE=3 SV=1 2 552 5.0E-153
sp|Q02RA9|PYRG_PSEAB CTP synthase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=pyrG PE=3 SV=1 2 552 5.0E-153
sp|B7V7V1|PYRG_PSEA8 CTP synthase OS=Pseudomonas aeruginosa (strain LESB58) GN=pyrG PE=3 SV=1 2 552 5.0E-153
sp|A6V1F1|PYRG_PSEA7 CTP synthase OS=Pseudomonas aeruginosa (strain PA7) GN=pyrG PE=3 SV=1 2 552 5.0E-153
sp|Q8E7P8|PYRG_STRA3 CTP synthase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=pyrG PE=3 SV=1 2 552 5.0E-153
sp|Q3K3S2|PYRG_STRA1 CTP synthase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=pyrG PE=3 SV=1 2 552 5.0E-153
sp|A0KGH2|PYRG_AERHH CTP synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=pyrG PE=3 SV=1 2 552 6.0E-153
sp|A6H0U1|PYRG_FLAPJ CTP synthase OS=Flavobacterium psychrophilum (strain JIP02/86 / ATCC 49511) GN=pyrG PE=3 SV=1 2 552 6.0E-153
sp|Q8Y0B8|PYRG_RALSO CTP synthase OS=Ralstonia solanacearum (strain GMI1000) GN=pyrG PE=3 SV=1 2 565 6.0E-153
sp|A8H1S4|PYRG_SHEPA CTP synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=pyrG PE=3 SV=1 2 562 6.0E-153
sp|A6VR01|PYRG_ACTSZ CTP synthase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=pyrG PE=3 SV=1 2 552 7.0E-153
sp|P44341|PYRG_HAEIN CTP synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=pyrG PE=3 SV=1 2 552 8.0E-153
sp|Q48RF1|PYRG_STRPM CTP synthase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=pyrG PE=3 SV=1 2 552 8.0E-153
sp|Q0KCE5|PYRG_CUPNH CTP synthase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=pyrG PE=3 SV=1 2 558 9.0E-153
sp|A1W4R3|PYRG_ACISJ CTP synthase OS=Acidovorax sp. (strain JS42) GN=pyrG PE=3 SV=1 2 552 1.0E-152
sp|Q2JLG7|PYRG_SYNJB CTP synthase OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=pyrG PE=3 SV=1 2 552 2.0E-152
sp|B0BS41|PYRG_ACTPJ CTP synthase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=pyrG PE=3 SV=1 2 552 2.0E-152
sp|B3GZX8|PYRG_ACTP7 CTP synthase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=pyrG PE=3 SV=1 2 552 2.0E-152
sp|Q980S6|PYRG_SULSO CTP synthase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=pyrG PE=1 SV=1 2 555 2.0E-152
sp|A1TLT0|PYRG_ACIAC CTP synthase OS=Acidovorax citrulli (strain AAC00-1) GN=pyrG PE=3 SV=1 2 552 2.0E-152
sp|B0TK03|PYRG_SHEHH CTP synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=pyrG PE=3 SV=1 2 562 2.0E-152
sp|P74208|PYRG_SYNY3 CTP synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pyrG PE=3 SV=1 2 562 2.0E-152
sp|Q8DWG1|PYRG_STRMU CTP synthase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=pyrG PE=3 SV=1 2 552 2.0E-152
sp|A4FKA9|PYRG_SACEN CTP synthase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=pyrG PE=3 SV=1 1 552 3.0E-152
sp|Q465Q4|PYRG_METBF CTP synthase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=pyrG PE=3 SV=1 1 558 3.0E-152
sp|A5UD28|PYRG_HAEIE CTP synthase OS=Haemophilus influenzae (strain PittEE) GN=pyrG PE=3 SV=1 2 552 3.0E-152
sp|Q97S93|PYRG_STRPN CTP synthase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=pyrG PE=3 SV=1 2 552 4.0E-152
sp|Q8TKW5|PYRG_METAC CTP synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=pyrG PE=3 SV=1 1 551 4.0E-152
sp|Q1LPI8|PYRG_CUPMC CTP synthase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=pyrG PE=3 SV=1 2 552 5.0E-152
sp|Q886M5|PYRG_PSESM CTP synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=pyrG PE=3 SV=1 2 552 5.0E-152
sp|Q63SP8|PYRG_BURPS CTP synthase OS=Burkholderia pseudomallei (strain K96243) GN=pyrG PE=3 SV=1 2 555 5.0E-152
sp|Q3JQQ4|PYRG_BURP1 CTP synthase OS=Burkholderia pseudomallei (strain 1710b) GN=pyrG PE=3 SV=1 2 555 5.0E-152
sp|A1V5K4|PYRG_BURMS CTP synthase OS=Burkholderia mallei (strain SAVP1) GN=pyrG PE=3 SV=1 2 555 5.0E-152
sp|Q62J08|PYRG_BURMA CTP synthase OS=Burkholderia mallei (strain ATCC 23344) GN=pyrG PE=3 SV=1 2 555 5.0E-152
sp|A3ML79|PYRG_BURM7 CTP synthase OS=Burkholderia mallei (strain NCTC 10247) GN=pyrG PE=3 SV=1 2 555 5.0E-152
sp|A5N3K4|PYRG_CLOK5 CTP synthase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=pyrG PE=3 SV=1 2 559 6.0E-152
sp|Q8DQY0|PYRG_STRR6 CTP synthase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pyrG PE=3 SV=1 2 552 6.0E-152
sp|Q2SXC7|PYRG_BURTA CTP synthase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=pyrG PE=3 SV=1 2 555 7.0E-152
sp|A3QC76|PYRG_SHELP CTP synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=pyrG PE=3 SV=1 2 558 7.0E-152
sp|A7Z9T4|PYRG_BACMF CTP synthase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=pyrG PE=3 SV=1 2 552 8.0E-152
sp|Q4ZWR0|PYRG_PSEU2 CTP synthase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=pyrG PE=3 SV=1 2 552 8.0E-152
sp|A1VLH3|PYRG_POLNA CTP synthase OS=Polaromonas naphthalenivorans (strain CJ2) GN=pyrG PE=3 SV=1 2 551 8.0E-152
sp|A1WL89|PYRG_VEREI CTP synthase OS=Verminephrobacter eiseniae (strain EF01-2) GN=pyrG PE=3 SV=1 2 552 9.0E-152
sp|Q8Q0L8|PYRG_METMA CTP synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=pyrG PE=3 SV=1 1 563 1.0E-151
sp|Q4QLL2|PYRG_HAEI8 CTP synthase OS=Haemophilus influenzae (strain 86-028NP) GN=pyrG PE=3 SV=1 2 552 1.0E-151
sp|Q5ZWA4|PYRG_LEGPH CTP synthase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=pyrG PE=3 SV=1 2 562 1.0E-151
sp|A5IB79|PYRG_LEGPC CTP synthase OS=Legionella pneumophila (strain Corby) GN=pyrG PE=3 SV=1 2 562 1.0E-151
sp|Q5X5Y6|PYRG_LEGPA CTP synthase OS=Legionella pneumophila (strain Paris) GN=pyrG PE=3 SV=1 2 562 1.0E-151
sp|Q2RT58|PYRG_RHORT CTP synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=pyrG PE=3 SV=1 2 552 1.0E-151
sp|A2SAU5|PYRG_BURM9 CTP synthase OS=Burkholderia mallei (strain NCTC 10229) GN=pyrG PE=3 SV=1 2 555 2.0E-151
sp|A1TZ46|PYRG_MARHV CTP synthase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=pyrG PE=3 SV=1 2 552 3.0E-151
sp|Q0APT7|PYRG_MARMM CTP synthase OS=Maricaulis maris (strain MCS10) GN=pyrG PE=3 SV=1 2 552 3.0E-151
sp|Q9CJW9|PYRG_PASMU CTP synthase OS=Pasteurella multocida (strain Pm70) GN=pyrG PE=3 SV=1 2 552 3.0E-151
sp|B0JU82|PYRG_MICAN CTP synthase OS=Microcystis aeruginosa (strain NIES-843) GN=pyrG PE=3 SV=1 2 552 3.0E-151
sp|B1KPT7|PYRG_SHEWM CTP synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=pyrG PE=3 SV=1 2 549 3.0E-151
sp|Q7V3W8|PYRG_PROMM CTP synthase OS=Prochlorococcus marinus (strain MIT 9313) GN=pyrG PE=3 SV=1 2 552 4.0E-151
sp|Q7VNV5|PYRG_HAEDU CTP synthase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=pyrG PE=3 SV=1 2 552 5.0E-151
sp|Q3KH94|PYRG_PSEPF CTP synthase OS=Pseudomonas fluorescens (strain Pf0-1) GN=pyrG PE=3 SV=1 2 552 7.0E-151
sp|A9BN39|PYRG_DELAS CTP synthase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=pyrG PE=3 SV=1 2 552 7.0E-151
sp|Q97CR8|PYRG_THEVO CTP synthase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=pyrG PE=3 SV=1 1 563 8.0E-151
sp|Q15QR7|PYRG_PSEA6 CTP synthase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=pyrG PE=3 SV=1 2 553 9.0E-151
sp|Q604M6|PYRG_METCA CTP synthase OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=pyrG PE=3 SV=1 2 552 9.0E-151
sp|A0M3I8|PYRG_GRAFK CTP synthase OS=Gramella forsetii (strain KT0803) GN=pyrG PE=3 SV=1 2 552 1.0E-150
sp|Q1DDB7|PYRG_MYXXD CTP synthase OS=Myxococcus xanthus (strain DK 1622) GN=pyrG PE=3 SV=1 2 552 1.0E-150
sp|Q4KHF8|PYRG_PSEF5 CTP synthase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=pyrG PE=3 SV=1 2 552 1.0E-150
sp|Q0A7K2|PYRG_ALKEH CTP synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=pyrG PE=3 SV=1 2 552 1.0E-150
sp|A4SRC2|PYRG_AERS4 CTP synthase OS=Aeromonas salmonicida (strain A449) GN=pyrG PE=3 SV=1 2 552 2.0E-150
sp|B2RKS1|PYRG_PORG3 CTP synthase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=pyrG PE=3 SV=1 2 552 2.0E-150
sp|Q88Z76|PYRG_LACPL CTP synthase OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=pyrG PE=3 SV=1 2 552 2.0E-150
sp|Q7VGH1|PYRG_HELHP CTP synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=pyrG PE=3 SV=1 1 549 2.0E-150
sp|Q8AA75|PYRG_BACTN CTP synthase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=pyrG PE=3 SV=1 2 552 2.0E-150
sp|Q49Z73|PYRG_STAS1 CTP synthase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=pyrG PE=3 SV=1 2 552 2.0E-150
sp|B5FAG0|PYRG_VIBFM CTP synthase OS=Vibrio fischeri (strain MJ11) GN=pyrG PE=3 SV=1 2 553 3.0E-150
sp|A2CDX8|PYRG_PROM3 CTP synthase OS=Prochlorococcus marinus (strain MIT 9303) GN=pyrG PE=3 SV=1 2 552 3.0E-150
sp|Q7MWR7|PYRG_PORGI CTP synthase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=pyrG PE=3 SV=1 2 552 3.0E-150
sp|Q8EBQ9|PYRG_SHEON CTP synthase OS=Shewanella oneidensis (strain MR-1) GN=pyrG PE=3 SV=1 2 561 3.0E-150
sp|B8HNM9|PYRG_CYAP4 CTP synthase OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=pyrG PE=3 SV=1 2 552 3.0E-150
sp|A9IIP5|PYRG_BORPD CTP synthase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=pyrG PE=3 SV=1 2 552 3.0E-150
sp|C4K4K0|PYRG_HAMD5 CTP synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=pyrG PE=3 SV=1 2 552 3.0E-150
sp|Q2J878|PYRG_FRASC CTP synthase OS=Frankia sp. (strain CcI3) GN=pyrG PE=3 SV=1 2 552 3.0E-150
sp|B4U6A9|PYRG_HYDS0 CTP synthase OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=pyrG PE=3 SV=1 2 552 5.0E-150
sp|Q11S24|PYRG_CYTH3 CTP synthase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=pyrG PE=3 SV=1 2 552 6.0E-150
sp|B2U9C0|PYRG_RALPJ CTP synthase OS=Ralstonia pickettii (strain 12J) GN=pyrG PE=3 SV=1 2 552 6.0E-150
sp|B2JIX2|PYRG_BURP8 CTP synthase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=pyrG PE=3 SV=1 2 552 6.0E-150
sp|A4WDW8|PYRG_ENT38 CTP synthase OS=Enterobacter sp. (strain 638) GN=pyrG PE=3 SV=1 2 561 7.0E-150
sp|Q0HXH1|PYRG_SHESR CTP synthase OS=Shewanella sp. (strain MR-7) GN=pyrG PE=3 SV=1 2 561 7.0E-150
sp|B6EKL9|PYRG_ALISL CTP synthase OS=Aliivibrio salmonicida (strain LFI1238) GN=pyrG PE=3 SV=1 2 553 7.0E-150
sp|Q3AGF7|PYRG_SYNSC CTP synthase OS=Synechococcus sp. (strain CC9605) GN=pyrG PE=3 SV=1 2 570 9.0E-150
sp|A5GPM2|PYRG_SYNPW CTP synthase OS=Synechococcus sp. (strain WH7803) GN=pyrG PE=3 SV=1 2 567 1.0E-149
sp|B6J4W8|PYRG_COXB1 CTP synthase OS=Coxiella burnetii (strain CbuK_Q154) GN=pyrG PE=3 SV=1 2 551 1.0E-149
sp|A1SSQ6|PYRG_PSYIN CTP synthase OS=Psychromonas ingrahamii (strain 37) GN=pyrG PE=3 SV=1 2 552 1.0E-149
sp|Q5E325|PYRG_VIBF1 CTP synthase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=pyrG PE=3 SV=1 3 553 1.0E-149
sp|A9KDH0|PYRG_COXBN CTP synthase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=pyrG PE=3 SV=1 2 551 2.0E-149
sp|Q0VQD8|PYRG_ALCBS CTP synthase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=pyrG PE=3 SV=1 2 552 2.0E-149
sp|B6IQ27|PYRG_RHOCS CTP synthase OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=pyrG PE=3 SV=1 2 552 2.0E-149
sp|Q0I200|PYRG_HAES1 CTP synthase OS=Haemophilus somnus (strain 129Pt) GN=pyrG PE=3 SV=2 2 553 2.0E-149
sp|Q110M9|PYRG_TRIEI CTP synthase OS=Trichodesmium erythraeum (strain IMS101) GN=pyrG PE=3 SV=1 2 552 2.0E-149
sp|A7MTS6|PYRG_VIBCB CTP synthase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=pyrG PE=3 SV=1 2 553 2.0E-149
sp|Q2FWD1|PYRG_STAA8 CTP synthase OS=Staphylococcus aureus (strain NCTC 8325) GN=pyrG PE=3 SV=1 2 552 3.0E-149
sp|B4EDA3|PYRG_BURCJ CTP synthase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=pyrG PE=3 SV=1 2 552 3.0E-149
sp|B1JUY8|PYRG_BURCC CTP synthase OS=Burkholderia cenocepacia (strain MC0-3) GN=pyrG PE=3 SV=1 2 552 3.0E-149
sp|Q8CNI2|PYRG_STAES CTP synthase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=pyrG PE=3 SV=1 2 552 3.0E-149
sp|Q5HM95|PYRG_STAEQ CTP synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=pyrG PE=3 SV=1 2 552 3.0E-149
sp|B6J3W7|PYRG_COXB2 CTP synthase OS=Coxiella burnetii (strain CbuG_Q212) GN=pyrG PE=3 SV=1 2 551 3.0E-149
sp|A0K8N3|PYRG_BURCH CTP synthase OS=Burkholderia cenocepacia (strain HI2424) GN=pyrG PE=3 SV=1 2 552 4.0E-149
sp|Q1BHS2|PYRG_BURCA CTP synthase OS=Burkholderia cenocepacia (strain AU 1054) GN=pyrG PE=3 SV=1 2 552 4.0E-149
sp|Q1QZX9|PYRG_CHRSD CTP synthase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=pyrG PE=3 SV=1 2 549 4.0E-149
sp|B8E8T0|PYRG_SHEB2 CTP synthase OS=Shewanella baltica (strain OS223) GN=pyrG PE=3 SV=1 2 561 4.0E-149
sp|A9KYH1|PYRG_SHEB9 CTP synthase OS=Shewanella baltica (strain OS195) GN=pyrG PE=3 SV=1 2 561 5.0E-149
sp|A6WR29|PYRG_SHEB8 CTP synthase OS=Shewanella baltica (strain OS185) GN=pyrG PE=3 SV=1 2 561 5.0E-149
sp|A3D796|PYRG_SHEB5 CTP synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=pyrG PE=3 SV=1 2 561 5.0E-149
sp|Q87LP9|PYRG_VIBPA CTP synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=pyrG PE=3 SV=1 2 553 6.0E-149
sp|Q0HL73|PYRG_SHESM CTP synthase OS=Shewanella sp. (strain MR-4) GN=pyrG PE=3 SV=1 2 561 6.0E-149
sp|B2SXV1|PYRG_BURPP CTP synthase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|A1WWZ4|PYRG_HALHL CTP synthase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|Q73HS5|PYRG_WOLPM CTP synthase OS=Wolbachia pipientis wMel GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|P65924|PYRG_STAAW CTP synthase OS=Staphylococcus aureus (strain MW2) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|A8YY92|PYRG_STAAT CTP synthase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|Q6G7I3|PYRG_STAAS CTP synthase OS=Staphylococcus aureus (strain MSSA476) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|Q6GEU8|PYRG_STAAR CTP synthase OS=Staphylococcus aureus (strain MRSA252) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|P99072|PYRG_STAAN CTP synthase OS=Staphylococcus aureus (strain N315) GN=pyrG PE=1 SV=1 2 552 7.0E-149
sp|P65923|PYRG_STAAM CTP synthase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|A6QIX1|PYRG_STAAE CTP synthase OS=Staphylococcus aureus (strain Newman) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|Q5HE73|PYRG_STAAC CTP synthase OS=Staphylococcus aureus (strain COL) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|Q2YUM6|PYRG_STAAB CTP synthase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|A5IUS2|PYRG_STAA9 CTP synthase OS=Staphylococcus aureus (strain JH9) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|Q2FF01|PYRG_STAA3 CTP synthase OS=Staphylococcus aureus (strain USA300) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|A6U3L2|PYRG_STAA2 CTP synthase OS=Staphylococcus aureus (strain JH1) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|A7X4X7|PYRG_STAA1 CTP synthase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=pyrG PE=3 SV=1 2 552 7.0E-149
sp|A8G7J4|PYRG_PROM2 CTP synthase OS=Prochlorococcus marinus (strain MIT 9215) GN=pyrG PE=3 SV=1 2 552 8.0E-149
sp|A4JFY7|PYRG_BURVG CTP synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=pyrG PE=3 SV=1 2 552 8.0E-149
sp|Q4FM39|PYRG_PELUB CTP synthase OS=Pelagibacter ubique (strain HTCC1062) GN=pyrG PE=3 SV=1 2 552 8.0E-149
sp|Q6A7X4|PYRG_PROAC CTP synthase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=pyrG PE=3 SV=1 2 549 9.0E-149
sp|A7MQY9|PYRG_CROS8 CTP synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=pyrG PE=3 SV=1 2 561 9.0E-149
sp|Q13X05|PYRG_BURXL CTP synthase OS=Burkholderia xenovorans (strain LB400) GN=pyrG PE=3 SV=1 2 552 9.0E-149
sp|B0SYY1|PYRG_CAUSK CTP synthase OS=Caulobacter sp. (strain K31) GN=pyrG PE=3 SV=1 2 552 1.0E-148
sp|A1JJR3|PYRG_YERE8 CTP synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=pyrG PE=3 SV=1 2 561 1.0E-148
sp|Q8ZSY7|PYRG_PYRAE CTP synthase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=pyrG PE=3 SV=1 2 552 1.0E-148
sp|A6TD54|PYRG_KLEP7 CTP synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=pyrG PE=3 SV=1 2 561 1.0E-148
sp|A1RHF2|PYRG_SHESW CTP synthase OS=Shewanella sp. (strain W3-18-1) GN=pyrG PE=3 SV=1 2 561 1.0E-148
sp|A4Y944|PYRG_SHEPC CTP synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=pyrG PE=3 SV=1 2 561 1.0E-148
sp|Q7U3K4|PYRG_SYNPX CTP synthase OS=Synechococcus sp. (strain WH8102) GN=pyrG PE=3 SV=1 2 552 1.0E-148
sp|Q47QN2|PYRG_THEFY CTP synthase OS=Thermobifida fusca (strain YX) GN=pyrG PE=3 SV=2 2 552 2.0E-148
sp|A2BZ76|PYRG_PROM5 CTP synthase OS=Prochlorococcus marinus (strain MIT 9515) GN=pyrG PE=3 SV=1 2 552 2.0E-148
sp|Q64T27|PYRG_BACFR CTP synthase OS=Bacteroides fragilis (strain YCH46) GN=pyrG PE=3 SV=1 2 552 2.0E-148
sp|Q5LC42|PYRG_BACFN CTP synthase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=pyrG PE=3 SV=1 2 552 2.0E-148
sp|Q0BDS1|PYRG_BURCM CTP synthase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=pyrG PE=3 SV=1 2 552 2.0E-148
sp|B1JK10|PYRG_YERPY CTP synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|Q66ED9|PYRG_YERPS CTP synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|A4TPY0|PYRG_YERPP CTP synthase OS=Yersinia pestis (strain Pestoides F) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|Q1CLT3|PYRG_YERPN CTP synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|A9R1D2|PYRG_YERPG CTP synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|Q8ZBN1|PYRG_YERPE CTP synthase OS=Yersinia pestis GN=pyrG PE=3 SV=3 2 561 2.0E-148
sp|B2K560|PYRG_YERPB CTP synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|Q1C3Y5|PYRG_YERPA CTP synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|A7FLZ6|PYRG_YERP3 CTP synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|Q2NVN8|PYRG_SODGM CTP synthase OS=Sodalis glossinidius (strain morsitans) GN=pyrG PE=3 SV=1 2 561 2.0E-148
sp|A0KU81|PYRG_SHESA CTP synthase OS=Shewanella sp. (strain ANA-3) GN=pyrG PE=3 SV=1 2 561 3.0E-148
sp|Q0BTX6|PYRG_GRABC CTP synthase OS=Granulibacter bethesdensis (strain ATCC BAA-1260 / CGDNIH1) GN=pyrG PE=3 SV=1 2 552 3.0E-148
sp|Q7MHQ0|PYRG_VIBVY CTP synthase OS=Vibrio vulnificus (strain YJ016) GN=pyrG PE=3 SV=2 2 553 3.0E-148
sp|Q8DC63|PYRG_VIBVU CTP synthase OS=Vibrio vulnificus (strain CMCP6) GN=pyrG PE=3 SV=1 2 553 3.0E-148
sp|A8G9W0|PYRG_SERP5 CTP synthase OS=Serratia proteamaculans (strain 568) GN=pyrG PE=3 SV=1 2 561 3.0E-148
sp|B5XV18|PYRG_KLEP3 CTP synthase OS=Klebsiella pneumoniae (strain 342) GN=pyrG PE=3 SV=1 2 561 4.0E-148
sp|Q47WQ9|PYRG_COLP3 CTP synthase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=pyrG PE=3 SV=1 2 552 4.0E-148
sp|Q9Z8U8|PYRG_CHLPN CTP synthase OS=Chlamydia pneumoniae GN=pyrG PE=3 SV=2 1 552 4.0E-148
sp|B4T484|PYRG_SALNS CTP synthase OS=Salmonella newport (strain SL254) GN=pyrG PE=3 SV=1 2 552 5.0E-148
sp|Q7UZH7|PYRG_PROMP CTP synthase OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=pyrG PE=3 SV=1 2 552 5.0E-148
sp|Q83B36|PYRG_COXBU CTP synthase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=pyrG PE=3 SV=1 2 551 6.0E-148
sp|Q7MAI3|PYRG_WOLSU CTP synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=pyrG PE=3 SV=1 2 552 6.0E-148
sp|B4TTY6|PYRG_SALSV CTP synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=pyrG PE=3 SV=1 2 553 6.0E-148
sp|C3LQZ1|PYRG_VIBCM CTP synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=pyrG PE=3 SV=1 2 553 8.0E-148
sp|Q9KPC4|PYRG_VIBCH CTP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=pyrG PE=3 SV=3 2 553 8.0E-148
sp|A5F5I4|PYRG_VIBC3 CTP synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=pyrG PE=3 SV=1 2 553 8.0E-148
sp|A8ANY8|PYRG_CITK8 CTP synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=pyrG PE=3 SV=1 2 561 8.0E-148
sp|B9DME0|PYRG_STACT CTP synthase OS=Staphylococcus carnosus (strain TM300) GN=pyrG PE=3 SV=1 2 552 8.0E-148
sp|Q39EV7|PYRG_BURL3 CTP synthase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=pyrG PE=3 SV=1 2 552 8.0E-148
sp|B1YT11|PYRG_BURA4 CTP synthase OS=Burkholderia ambifaria (strain MC40-6) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|Q74BY3|PYRG_GEOSL CTP synthase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|A2BTS1|PYRG_PROMS CTP synthase OS=Prochlorococcus marinus (strain AS9601) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|Q0I677|PYRG_SYNS3 CTP synthase OS=Synechococcus sp. (strain CC9311) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|A7HIF0|PYRG_ANADF CTP synthase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|P65921|PYRG_SALTY CTP synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=pyrG PE=3 SV=2 2 552 1.0E-147
sp|P65922|PYRG_SALTI CTP synthase OS=Salmonella typhi GN=pyrG PE=3 SV=2 2 552 1.0E-147
sp|C0PXD6|PYRG_SALPC CTP synthase OS=Salmonella paratyphi C (strain RKS4594) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|A9N2F5|PYRG_SALPB CTP synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|B4TFZ2|PYRG_SALHS CTP synthase OS=Salmonella heidelberg (strain SL476) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|B5RDS6|PYRG_SALG2 CTP synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|B5QW41|PYRG_SALEP CTP synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|B5FTV0|PYRG_SALDC CTP synthase OS=Salmonella dublin (strain CT_02021853) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|Q57KG9|PYRG_SALCH CTP synthase OS=Salmonella choleraesuis (strain SC-B67) GN=pyrG PE=3 SV=1 2 552 1.0E-147
sp|C6DDJ6|PYRG_PECCP CTP synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=pyrG PE=3 SV=1 2 561 1.0E-147
sp|B2I2A7|PYRG_ACIBC CTP synthase OS=Acinetobacter baumannii (strain ACICU) GN=pyrG PE=3 SV=1 3 552 1.0E-147
sp|Q2KZF8|PYRG_BORA1 CTP synthase OS=Bordetella avium (strain 197N) GN=pyrG PE=3 SV=1 2 558 1.0E-147
sp|Q21V39|PYRG_RHOFT CTP synthase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=pyrG PE=3 SV=1 2 552 2.0E-147
sp|B4RVU4|PYRG_ALTMD CTP synthase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=pyrG PE=3 SV=1 2 553 2.0E-147
sp|B0V675|PYRG_ACIBY CTP synthase OS=Acinetobacter baumannii (strain AYE) GN=pyrG PE=3 SV=1 3 552 2.0E-147
sp|A3M5Y3|PYRG_ACIBT CTP synthase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=pyrG PE=3 SV=2 3 552 2.0E-147
sp|B0VQI6|PYRG_ACIBS CTP synthase OS=Acinetobacter baumannii (strain SDF) GN=pyrG PE=3 SV=1 3 552 2.0E-147
sp|B7I920|PYRG_ACIB5 CTP synthase OS=Acinetobacter baumannii (strain AB0057) GN=pyrG PE=3 SV=1 3 552 2.0E-147
sp|B7H225|PYRG_ACIB3 CTP synthase OS=Acinetobacter baumannii (strain AB307-0294) GN=pyrG PE=3 SV=1 3 552 2.0E-147
sp|B5BF03|PYRG_SALPK CTP synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=pyrG PE=3 SV=1 2 552 2.0E-147
sp|Q5PEJ0|PYRG_SALPA CTP synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=pyrG PE=3 SV=1 2 552 2.0E-147
sp|B5F4P0|PYRG_SALA4 CTP synthase OS=Salmonella agona (strain SL483) GN=pyrG PE=3 SV=1 2 552 2.0E-147
sp|Q6D181|PYRG_PECAS CTP synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|Q3YY76|PYRG_SHISS CTP synthase OS=Shigella sonnei (strain Ss046) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|P0A7E8|PYRG_SHIFL CTP synthase OS=Shigella flexneri GN=pyrG PE=3 SV=2 2 561 3.0E-147
sp|Q0T1P8|PYRG_SHIF8 CTP synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|Q32CD5|PYRG_SHIDS CTP synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|Q31XL0|PYRG_SHIBS CTP synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B2TZF3|PYRG_SHIB3 CTP synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B7LWP4|PYRG_ESCF3 CTP synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|Q1R7R3|PYRG_ECOUT CTP synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B1LQB3|PYRG_ECOSM CTP synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B6I6H6|PYRG_ECOSE CTP synthase OS=Escherichia coli (strain SE11) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B7N716|PYRG_ECOLU CTP synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|P0A7E5|PYRG_ECOLI CTP synthase OS=Escherichia coli (strain K12) GN=pyrG PE=1 SV=2 2 561 3.0E-147
sp|B1IU61|PYRG_ECOLC CTP synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|P0A7E6|PYRG_ECOL6 CTP synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=pyrG PE=3 SV=2 2 561 3.0E-147
sp|Q0TE79|PYRG_ECOL5 CTP synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|A1AEW8|PYRG_ECOK1 CTP synthase OS=Escherichia coli O1:K1 / APEC GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|A8A3R5|PYRG_ECOHS CTP synthase OS=Escherichia coli O9:H4 (strain HS) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B1XDJ0|PYRG_ECODH CTP synthase OS=Escherichia coli (strain K12 / DH10B) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|C4ZZT3|PYRG_ECOBW CTP synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B7LXJ6|PYRG_ECO8A CTP synthase OS=Escherichia coli O8 (strain IAI1) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B7MZ76|PYRG_ECO81 CTP synthase OS=Escherichia coli O81 (strain ED1a) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B7NV70|PYRG_ECO7I CTP synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B5Z3E4|PYRG_ECO5E CTP synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|P0A7E7|PYRG_ECO57 CTP synthase OS=Escherichia coli O157:H7 GN=pyrG PE=3 SV=2 2 561 3.0E-147
sp|B7LEK0|PYRG_ECO55 CTP synthase OS=Escherichia coli (strain 55989 / EAEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|B7MLA1|PYRG_ECO45 CTP synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|A7ZQM3|PYRG_ECO24 CTP synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=pyrG PE=3 SV=1 2 561 3.0E-147
sp|A9MF10|PYRG_SALAR CTP synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=pyrG PE=3 SV=1 2 553 4.0E-147
sp|Q1LTN7|PYRG_BAUCH CTP synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=pyrG PE=3 SV=1 2 553 4.0E-147
sp|B4EUF6|PYRG_PROMH CTP synthase OS=Proteus mirabilis (strain HI4320) GN=pyrG PE=3 SV=1 2 552 5.0E-147
sp|B7UHJ6|PYRG_ECO27 CTP synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=pyrG PE=3 SV=1 2 561 5.0E-147
sp|Q2IH81|PYRG_ANADE CTP synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=pyrG PE=3 SV=1 2 552 5.0E-147
sp|B8JBN6|PYRG_ANAD2 CTP synthase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=pyrG PE=3 SV=1 2 552 6.0E-147
sp|Q7NSG9|PYRG_CHRVO CTP synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=pyrG PE=3 SV=1 2 552 6.0E-147
sp|Q3JCT3|PYRG_NITOC CTP synthase OS=Nitrosococcus oceani (strain ATCC 19707 / NCIMB 11848) GN=pyrG PE=3 SV=1 2 560 7.0E-147
sp|Q3AUG4|PYRG_SYNS9 CTP synthase OS=Synechococcus sp. (strain CC9902) GN=pyrG PE=3 SV=1 2 552 9.0E-147
sp|A9N9V5|PYRG_COXBR CTP synthase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=pyrG PE=3 SV=1 2 551 9.0E-147
sp|Q3A371|PYRG_PELCD CTP synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=pyrG PE=3 SV=1 2 552 1.0E-146
sp|B8GQ73|PYRG_THISH CTP synthase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=pyrG PE=3 SV=1 2 552 2.0E-146
sp|B7VK69|PYRG_VIBTL CTP synthase OS=Vibrio tasmaniensis (strain LGP32) GN=pyrG PE=3 SV=1 2 553 2.0E-146
sp|A9AGW0|PYRG_BURM1 CTP synthase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=pyrG PE=3 SV=1 2 552 2.0E-146
sp|B2VFY9|PYRG_ERWT9 CTP synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=pyrG PE=3 SV=1 2 561 2.0E-146
sp|B4UIT6|PYRG_ANASK CTP synthase OS=Anaeromyxobacter sp. (strain K) GN=pyrG PE=3 SV=1 2 552 2.0E-146
sp|Q9A7K3|PYRG_CAUCR CTP synthase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=pyrG PE=3 SV=1 2 552 3.0E-146
sp|B8GW64|PYRG_CAUCN CTP synthase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=pyrG PE=3 SV=1 2 552 3.0E-146
sp|Q1GTY6|PYRG_SPHAL CTP synthase OS=Sphingopyxis alaskensis (strain DSM 13593 / LMG 18877 / RB2256) GN=pyrG PE=3 SV=1 2 552 3.0E-146
sp|B4SAT4|PYRG_PELPB CTP synthase OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=pyrG PE=3 SV=1 1 566 3.0E-146
sp|C5B8X3|PYRG_EDWI9 CTP synthase OS=Edwardsiella ictaluri (strain 93-146) GN=pyrG PE=3 SV=1 2 561 4.0E-146
sp|Q5R142|PYRG_IDILO CTP synthase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=pyrG PE=3 SV=1 2 558 4.0E-146
sp|Q128E7|PYRG_POLSJ CTP synthase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=pyrG PE=3 SV=1 2 559 4.0E-146
sp|A9M0Y3|PYRG_NEIM0 CTP synthase OS=Neisseria meningitidis serogroup C (strain 053442) GN=pyrG PE=3 SV=1 2 557 4.0E-146
sp|Q5NZ71|PYRG_AROAE CTP synthase OS=Aromatoleum aromaticum (strain EbN1) GN=pyrG PE=3 SV=1 2 550 5.0E-146
sp|Q7UJ86|PYRG_RHOBA CTP synthase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=pyrG PE=3 SV=1 2 568 5.0E-146
sp|Q5LTV0|PYRG_RUEPO CTP synthase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=pyrG PE=3 SV=1 2 552 6.0E-146
sp|O67353|PYRG_AQUAE CTP synthase OS=Aquifex aeolicus (strain VF5) GN=pyrG PE=3 SV=1 2 556 6.0E-146
sp|Q5GTB4|PYRG_WOLTR CTP synthase OS=Wolbachia sp. subsp. Brugia malayi (strain TRS) GN=pyrG PE=3 SV=1 2 551 7.0E-146
sp|A3PFH8|PYRG_PROM0 CTP synthase OS=Prochlorococcus marinus (strain MIT 9301) GN=pyrG PE=3 SV=1 2 552 8.0E-146
sp|Q7VW76|PYRG_BORPE CTP synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=pyrG PE=3 SV=1 2 552 8.0E-146
sp|Q7W5N6|PYRG_BORPA CTP synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=pyrG PE=3 SV=1 2 552 8.0E-146
sp|Q7WD72|PYRG_BORBR CTP synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=pyrG PE=3 SV=1 2 552 8.0E-146
sp|Q8YHF2|PYRG_BRUME CTP synthase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=pyrG PE=3 SV=1 2 552 1.0E-145
sp|Q9JYJ8|PYRG_NEIMB CTP synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=pyrG PE=3 SV=1 2 557 1.0E-145
sp|B8DJR8|PYRG_DESVM CTP synthase OS=Desulfovibrio vulgaris (strain Miyazaki F / DSM 19637) GN=pyrG PE=3 SV=1 2 552 1.0E-145
sp|Q4L808|PYRG_STAHJ CTP synthase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=pyrG PE=3 SV=1 2 552 1.0E-145
sp|Q976E9|PYRG_SULTO CTP synthase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=pyrG PE=3 SV=2 2 555 1.0E-145
sp|Q3ZYU1|PYRG_DEHMC CTP synthase OS=Dehalococcoides mccartyi (strain CBDB1) GN=pyrG PE=3 SV=1 2 552 1.0E-145
sp|A5FPS8|PYRG_DEHMB CTP synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2100 / JCM 16839 / KCTC 5957 / BAV1) GN=pyrG PE=3 SV=1 2 552 1.0E-145
sp|A1KUX8|PYRG_NEIMF CTP synthase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=pyrG PE=3 SV=1 2 557 1.0E-145
sp|Q4JAK8|PYRG_SULAC CTP synthase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=pyrG PE=3 SV=1 2 554 2.0E-145
sp|Q3Z6N1|PYRG_DEHM1 CTP synthase OS=Dehalococcoides mccartyi (strain ATCC BAA-2266 / KCTC 15142 / 195) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|B0U0L7|PYRG_FRAP2 CTP synthase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|Q317V2|PYRG_PROM9 CTP synthase OS=Prochlorococcus marinus (strain MIT 9312) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|Q9JTK1|PYRG_NEIMA CTP synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=pyrG PE=3 SV=1 2 557 2.0E-145
sp|Q3IDM3|PYRG_PSEHT CTP synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|Q6FAT7|PYRG_ACIAD CTP synthase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=pyrG PE=3 SV=1 3 552 2.0E-145
sp|Q57D05|PYRG_BRUAB CTP synthase OS=Brucella abortus biovar 1 (strain 9-941) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|Q2YPU8|PYRG_BRUA2 CTP synthase OS=Brucella abortus (strain 2308) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|B2IUT0|PYRG_NOSP7 CTP synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|Q5FME6|PYRG_LACAC CTP synthase OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=pyrG PE=3 SV=1 2 554 2.0E-145
sp|A5VQQ9|PYRG_BRUO2 CTP synthase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|C0RJA5|PYRG_BRUMB CTP synthase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=pyrG PE=3 SV=1 2 552 2.0E-145
sp|O87761|PYRG_LACLM CTP synthase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=pyrG PE=3 SV=2 2 552 3.0E-145
sp|O25116|PYRG_HELPY CTP synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=pyrG PE=3 SV=1 2 552 3.0E-145
sp|B0CGT4|PYRG_BRUSI CTP synthase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=pyrG PE=3 SV=1 2 552 3.0E-145
sp|B1Y4K6|PYRG_LEPCP CTP synthase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=pyrG PE=3 SV=1 2 536 3.0E-145
sp|B3EE77|PYRG_CHLL2 CTP synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=pyrG PE=3 SV=1 1 552 3.0E-145
sp|B4RJ40|PYRG_NEIG2 CTP synthase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=pyrG PE=3 SV=1 2 557 4.0E-145
sp|Q5F7G6|PYRG_NEIG1 CTP synthase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=pyrG PE=3 SV=1 2 557 4.0E-145
sp|Q1CUG1|PYRG_HELPH CTP synthase OS=Helicobacter pylori (strain HPAG1) GN=pyrG PE=3 SV=1 2 552 4.0E-145
sp|B2S5Y5|PYRG_BRUA1 CTP synthase OS=Brucella abortus (strain S19) GN=pyrG PE=3 SV=1 2 552 4.0E-145
sp|Q3SL45|PYRG_THIDA CTP synthase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=pyrG PE=3 SV=1 2 552 4.0E-145
sp|B3QWC0|PYRG_CHLT3 CTP synthase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=pyrG PE=3 SV=1 1 552 6.0E-145
sp|A1SJK4|PYRG_NOCSJ CTP synthase OS=Nocardioides sp. (strain BAA-499 / JS614) GN=pyrG PE=3 SV=1 2 552 6.0E-145
sp|Q0C195|PYRG_HYPNA CTP synthase OS=Hyphomonas neptunium (strain ATCC 15444) GN=pyrG PE=3 SV=1 1 552 6.0E-145
sp|Q39W62|PYRG_GEOMG CTP synthase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=pyrG PE=3 SV=1 2 552 6.0E-145
sp|Q2IWB8|PYRG_RHOP2 CTP synthase OS=Rhodopseudomonas palustris (strain HaA2) GN=pyrG PE=3 SV=1 2 552 6.0E-145
sp|C1DCC1|PYRG_LARHH CTP synthase OS=Laribacter hongkongensis (strain HLHK9) GN=pyrG PE=3 SV=1 2 552 8.0E-145
sp|O26519|PYRG_METTH CTP synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=pyrG PE=3 SV=1 2 558 9.0E-145
sp|Q21LC4|PYRG_SACD2 CTP synthase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=pyrG PE=3 SV=1 2 552 9.0E-145
sp|P57491|PYRG_BUCAI CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=pyrG PE=3 SV=1 3 553 9.0E-145
sp|Q9ZM99|PYRG_HELPJ CTP synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=pyrG PE=3 SV=1 2 558 1.0E-144
sp|Q2NAA7|PYRG_ERYLH CTP synthase OS=Erythrobacter litoralis (strain HTCC2594) GN=pyrG PE=3 SV=1 2 552 1.0E-144
sp|Q6MPP0|PYRG_BDEBA CTP synthase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=pyrG PE=3 SV=2 2 552 1.0E-144
sp|A4SXE7|PYRG_POLSQ CTP synthase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=pyrG PE=3 SV=1 2 552 1.0E-144
sp|B8D7U6|PYRG_BUCAT CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=pyrG PE=3 SV=1 3 553 1.0E-144
sp|B8IZF5|PYRG_DESDA CTP synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=pyrG PE=3 SV=1 2 552 2.0E-144
sp|Q6G027|PYRG_BARQU CTP synthase OS=Bartonella quintana (strain Toulouse) GN=pyrG PE=3 SV=1 2 552 2.0E-144
sp|Q1H009|PYRG_METFK CTP synthase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=pyrG PE=3 SV=1 2 552 2.0E-144
sp|B0RUK3|PYRG_XANCB CTP synthase OS=Xanthomonas campestris pv. campestris (strain B100) GN=pyrG PE=3 SV=1 4 552 2.0E-144
sp|B0U802|PYRG_METS4 CTP synthase OS=Methylobacterium sp. (strain 4-46) GN=pyrG PE=3 SV=1 2 552 2.0E-144
sp|A8LIN6|PYRG_DINSH CTP synthase OS=Dinoroseobacter shibae (strain DSM 16493 / NCIMB 14021 / DFL 12) GN=pyrG PE=3 SV=1 2 552 2.0E-144
sp|Q11HU6|PYRG_CHESB CTP synthase OS=Chelativorans sp. (strain BNC1) GN=pyrG PE=3 SV=2 2 552 2.0E-144
sp|Q8PLS3|PYRG_XANAC CTP synthase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=pyrG PE=3 SV=1 4 552 2.0E-144
sp|A5EW22|PYRG_DICNV CTP synthase OS=Dichelobacter nodosus (strain VCS1703A) GN=pyrG PE=3 SV=1 2 552 2.0E-144
sp|Q8P9Z6|PYRG_XANCP CTP synthase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=pyrG PE=3 SV=1 4 552 2.0E-144
sp|Q4UTN9|PYRG_XANC8 CTP synthase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=pyrG PE=3 SV=2 4 552 2.0E-144
sp|Q8G0G1|PYRG_BRUSU CTP synthase OS=Brucella suis biovar 1 (strain 1330) GN=pyrG PE=3 SV=1 2 552 3.0E-144
sp|A9M5E7|PYRG_BRUC2 CTP synthase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=pyrG PE=3 SV=1 2 552 3.0E-144
sp|B8D9J4|PYRG_BUCA5 CTP synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=pyrG PE=3 SV=1 3 553 3.0E-144
[Show less]

GO

GO Term Description Terminal node
GO:0003883 CTP synthase activity Yes
GO:0006221 pyrimidine nucleotide biosynthetic process Yes
GO:0016787 hydrolase activity Yes
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0072528 pyrimidine-containing compound biosynthetic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0009165 nucleotide biosynthetic process No
GO:0006796 phosphate-containing compound metabolic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009117 nucleotide metabolic process No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0090407 organophosphate biosynthetic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0006220 pyrimidine nucleotide metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:1901293 nucleoside phosphate biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0016879 ligase activity, forming carbon-nitrogen bonds No
GO:0019637 organophosphate metabolic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006753 nucleoside phosphate metabolic process No
GO:0003674 molecular_function No
GO:0044249 cellular biosynthetic process No
GO:0018130 heterocycle biosynthetic process No
GO:0006793 phosphorus metabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6712
MKYVVVSGGVVSGVGKGIIASSAGLLLKTIGLKVTAIKIDPYINVDAGTMNPKEHGECFVLKDGGESDLDLGNYE
RYLALDLTRDNNITTGKIYKDVIERERRGDYLGRTVQVVPHVTSAIIDHIERVSRISVDGTGSEPDVCIIELGGT
LGDIESMPFVEALSQLRHKVGKNDSINIFVSYIPIVNGELKTKPTQHAVKCVRSAGLIPDLVACRCERPLDTVTM
AKIAQNCQIEAEQVVAVRDMPTIYQVPILLEQQGLLELLRHALILDKVPLSPALVTKGAETWKKWNAIIPREHTE
KIDIALVGKYVELPDAYLSVVKSLEHSAMRCGRKLNLVWIDAEQLEDKAKEADPVGFYKAWHQVSTAAGILVPGG
FGQRGTEGMIKAAQWARERKTPYLGVCLGMQVAVIEYARHVCGRAHATSEEFNAQAEHRVVIFMPEGSKETMGGT
MRLGERATHFQPGSEHSKLRALYGEATVIEERHRHRYEVNPDHVDELEAAGLHFIGKDDSGRRMEILELANHPWF
VGVQYHPEYLSRVLNPSRPYLGFVAAAAGCLHRITKDILAEAKDINGAGDGSRF*
Coding >Ophun1|6712
ATGAAGTACGTCGTCGTCTCCGGAGGCGTCGTCAGCGGCGTCGGCAAGGGCATCATCGCCTCGTCCGCCGGTCTG
CTTCTCAAGACAATCGGCCTCAAGGTGACGGCCATCAAAATCGACCCCTACATCAATGTCGACGCCGGAACCATG
AATCCAAAGGAACACGGCGAGTGTTTCGTCCTCAAGGATGGCGGCGAGTCGGACTTGGATCTGGGAAACTACGAG
CGCTATCTGGCTTTGGACCTCACGCGCGATAACAACATCACTACGGGCAAGATCTACAAGGACGTCATCGAAAGA
GAGCGTCGTGGCGACTACCTGGGTCGCACCGTTCAAGTGGTTCCTCACGTCACCTCGGCCATCATCGATCACATC
GAGCGTGTATCGAGAATCTCGGTTGACGGGACCGGCTCAGAACCCGACGTTTGCATCATCGAGTTGGGTGGCACT
CTCGGTGATATTGAGAGCATGCCTTTTGTCGAGGCTCTTTCGCAACTACGTCACAAGGTCGGCAAGAACGATTCG
ATCAACATCTTCGTCTCCTACATACCCATTGTCAACGGGGAGCTGAAGACGAAGCCGACACAGCACGCCGTGAAG
TGCGTCCGTAGTGCGGGCCTGATTCCGGACCTTGTGGCTTGTCGCTGTGAGCGGCCCCTGGATACGGTGACGATG
GCCAAAATCGCACAAAACTGTCAGATAGAGGCGGAACAGGTCGTGGCAGTTCGGGATATGCCCACCATCTACCAA
GTCCCGATCTTGCTGGAGCAACAAGGCCTCCTAGAGCTCCTGCGCCACGCTCTCATCTTGGACAAGGTGCCATTA
TCGCCGGCACTCGTGACCAAGGGCGCCGAGACATGGAAGAAGTGGAATGCCATCATCCCGCGAGAGCACACGGAG
AAGATTGACATCGCCCTCGTCGGCAAATACGTCGAACTTCCCGACGCCTACCTGTCGGTCGTCAAGTCGCTCGAG
CACTCGGCTATGCGCTGCGGCCGCAAGCTCAACCTGGTGTGGATCGACGCGGAGCAGCTGGAGGACAAGGCCAAG
GAGGCGGATCCCGTTGGCTTCTACAAGGCCTGGCACCAGGTCTCGACGGCTGCCGGCATCCTCGTCCCTGGCGGC
TTCGGCCAGCGAGGGACAGAGGGCATGATCAAGGCGGCTCAGTGGGCCCGAGAGCGCAAGACGCCCTACCTCGGC
GTCTGTCTGGGCATGCAGGTCGCCGTCATCGAATACGCGCGCCACGTGTGCGGCAGGGCTCACGCTACGTCGGAG
GAGTTCAACGCGCAGGCCGAGCACCGCGTCGTCATCTTCATGCCCGAAGGCTCCAAGGAGACGATGGGCGGCACC
ATGCGACTGGGCGAGCGCGCTACTCACTTCCAGCCGGGCAGCGAACACAGCAAGCTGCGCGCCTTGTACGGTGAA
GCCACCGTCATCGAGGAACGTCATCGTCACCGCTACGAGGTTAACCCGGACCATGTGGACGAACTCGAGGCGGCG
GGCCTGCACTTCATCGGCAAAGACGACTCGGGCCGGCGCATGGAGATCTTGGAGCTCGCCAACCATCCCTGGTTT
GTCGGCGTGCAGTACCATCCCGAGTATCTGAGCCGGGTACTGAACCCATCCCGGCCGTACCTGGGCTTCGTCGCC
GCTGCAGCCGGCTGTCTCCACAGGATTACGAAGGATATCCTGGCCGAGGCCAAAGATATCAACGGCGCTGGTGAC
GGATCGCGATTCTGA
Transcript >Ophun1|6712
ATGAAGTACGTCGTCGTCTCCGGAGGCGTCGTCAGCGGCGTCGGCAAGGGCATCATCGCCTCGTCCGCCGGTCTG
CTTCTCAAGACAATCGGCCTCAAGGTGACGGCCATCAAAATCGACCCCTACATCAATGTCGACGCCGGAACCATG
AATCCAAAGGAACACGGCGAGTGTTTCGTCCTCAAGGATGGCGGCGAGTCGGACTTGGATCTGGGAAACTACGAG
CGCTATCTGGCTTTGGACCTCACGCGCGATAACAACATCACTACGGGCAAGATCTACAAGGACGTCATCGAAAGA
GAGCGTCGTGGCGACTACCTGGGTCGCACCGTTCAAGTGGTTCCTCACGTCACCTCGGCCATCATCGATCACATC
GAGCGTGTATCGAGAATCTCGGTTGACGGGACCGGCTCAGAACCCGACGTTTGCATCATCGAGTTGGGTGGCACT
CTCGGTGATATTGAGAGCATGCCTTTTGTCGAGGCTCTTTCGCAACTACGTCACAAGGTCGGCAAGAACGATTCG
ATCAACATCTTCGTCTCCTACATACCCATTGTCAACGGGGAGCTGAAGACGAAGCCGACACAGCACGCCGTGAAG
TGCGTCCGTAGTGCGGGCCTGATTCCGGACCTTGTGGCTTGTCGCTGTGAGCGGCCCCTGGATACGGTGACGATG
GCCAAAATCGCACAAAACTGTCAGATAGAGGCGGAACAGGTCGTGGCAGTTCGGGATATGCCCACCATCTACCAA
GTCCCGATCTTGCTGGAGCAACAAGGCCTCCTAGAGCTCCTGCGCCACGCTCTCATCTTGGACAAGGTGCCATTA
TCGCCGGCACTCGTGACCAAGGGCGCCGAGACATGGAAGAAGTGGAATGCCATCATCCCGCGAGAGCACACGGAG
AAGATTGACATCGCCCTCGTCGGCAAATACGTCGAACTTCCCGACGCCTACCTGTCGGTCGTCAAGTCGCTCGAG
CACTCGGCTATGCGCTGCGGCCGCAAGCTCAACCTGGTGTGGATCGACGCGGAGCAGCTGGAGGACAAGGCCAAG
GAGGCGGATCCCGTTGGCTTCTACAAGGCCTGGCACCAGGTCTCGACGGCTGCCGGCATCCTCGTCCCTGGCGGC
TTCGGCCAGCGAGGGACAGAGGGCATGATCAAGGCGGCTCAGTGGGCCCGAGAGCGCAAGACGCCCTACCTCGGC
GTCTGTCTGGGCATGCAGGTCGCCGTCATCGAATACGCGCGCCACGTGTGCGGCAGGGCTCACGCTACGTCGGAG
GAGTTCAACGCGCAGGCCGAGCACCGCGTCGTCATCTTCATGCCCGAAGGCTCCAAGGAGACGATGGGCGGCACC
ATGCGACTGGGCGAGCGCGCTACTCACTTCCAGCCGGGCAGCGAACACAGCAAGCTGCGCGCCTTGTACGGTGAA
GCCACCGTCATCGAGGAACGTCATCGTCACCGCTACGAGGTTAACCCGGACCATGTGGACGAACTCGAGGCGGCG
GGCCTGCACTTCATCGGCAAAGACGACTCGGGCCGGCGCATGGAGATCTTGGAGCTCGCCAACCATCCCTGGTTT
GTCGGCGTGCAGTACCATCCCGAGTATCTGAGCCGGGTACTGAACCCATCCCGGCCGTACCTGGGCTTCGTCGCC
GCTGCAGCCGGCTGTCTCCACAGGATTACGAAGGATATCCTGGCCGAGGCCAAAGATATCAACGGCGCTGGTGAC
GGATCGCGATTCTGA
Gene >Ophun1|6712
ATGAAGTACGTCGTCGTCTCCGGAGGCGTCGTCAGCGGCGTCGGCAAGGGCATCATCGCCTCGTCCGCCGGTCTG
CTTCTCAAGACAATCGGCCTCAAGGTGACGGCCATCAAAATCGACCCCTACATCAATGTCGACGCCGGAACCATG
AATCCAAAGGAGTGAGTGTCGCCCAATCGGGGAGCCGTCATGATTGCTGAGGCTCGTCCAGACACGGCGAGTGTT
TCGTCCTCAAGGATGGCGGCGAGTCGGACTTGGATCTGGGAAACTACGAGCGGTAGGTCATATTCGTCTTGGCCC
TCCCAGAGTCTGGCTGATCAAGTCCAATGGGCAGCTATCTGGCTTTGGACCTCACGCGCGATAACAACATCACTA
CGGGCAAGATCTACAAGGACGTCATCGAAAGAGAGCGTCGTGGCGACTACCTGGGTCGCACCGTTCAAGTGGTTC
CTCACGTCACCTCGGCCATCATCGATCACATCGAGCGTGTATCGAGAATCTCGGTTGACGGGACCGGCTCAGAAC
CCGACGTTTGCATCAGTACGTAACAAGCCTTCCCGGCTCTCGCGTCGCTTGTCGCTAACGCCCAGTCTCCAGTCG
AGTTGGTAAGTCCGACGTCTACTTATTCGGCGGCTCTATCATCTGACGCGTGTCCAGGGTGGCACTCTCGGTGAT
ATTGAGAGCATGCCTTTTGTCGAGGCTCTTTCGCAACTACGTCACAAGGTCGGCAAGAACGATTCGATCAACATC
TTCGTCTCCTACATACCCATTGTCAACGGGGAGCTGAAGACGAAGCCGACACAGCACGCCGTGAAGTGCGTCCGT
AGTGCGGGCCTGATTCCGGACCTTGTGAGTTGGCTCGCCTTCTCTCTATTCGTCTGTTGGCTAAAAGTATTGTTT
GCAGGTGGCTTGTCGCTGTGAGCGGCCCCTGGATACGGTGACGATGGCCAAAATCGCACAAAACTGTCAGATAGA
GGCGGAACAGGTCGTGGCAGTTCGGGATATGCCCACCATCTACCAAGTCCCGATCTTGCTGGAGCAACAAGGCCT
CCTAGAGCTCCTGCGCCACGCTCTCATCTTGGACAAGGTGCCATTATCGCCGGCACTCGTGACCAAGGGCGCCGA
GACATGGAAGAAGTGGAATGCCATCATCCCGCGAGAGCACACGGAGAAGATTGACATCGCCCTCGTCGGCAAATA
CGTCGAACTTCCCGACGCCTACCTGTCGGTCGTCAAGTCGCTCGAGCACTCGGCTATGCGCTGCGGCCGCAAGCT
CAACCTGGTGTGGATCGACGCGGAGCAGCTGGAGGACAAGGCCAAGGAGGCGGATCCCGTTGGCTTCTACAAGGC
CTGGCACCAGGTCTCGACGGCTGCCGGCATCCTCGTCCCTGGCGGCTTCGGCCAGCGAGGGACAGAGGGCATGAT
CAAGGCGGCTCAGTGGGCCCGAGAGCGCAAGACGCCCTACCTCGGCGTCTGTCTGGGCATGCAGGTCGCCGTCAT
CGAATACGCGCGCCACGTGTGCGGCAGGGCTCACGCTACGTCGGAGGAGTTCAACGCGCAGGCCGAGCACCGCGT
CGTCATCTTCATGCCCGAAGGCTCCAAGGAGACGATGGGCGGCACCATGCGACTGGGCGAGCGCGCTACTCACTT
CCAGCCGGGCAGCGAACACAGCAAGCTGCGCGCCTTGTACGGTGAAGCCACCGTCATCGAGGAACGTCATCGTCA
CCGCTACGAGGTTAACCCGGACCATGTGGACGAACTCGAGGCGGCGGGCCTGCACTTCATCGGCAAAGACGACTC
GGGCCGGCGCATGGAGATCTTGGAGCTCGCCAACCATCCCTGGTTTGTCGGCGTGCAGTACCATCCCGAGTATCT
GAGCCGGGTACTGAACCCATCCCGGCCGTACCTGGGCTTCGTCGCCGCTGCAGCCGGCTGTCTCCACAGGATTAC
GAAGGATATCCTGGCCGAGGCCAAAGATATCAACGGCGCTGGTGACGGATCGCGATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail