Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6705
Gene name
LocationContig_759:3634..5802
Strand+
Gene length (bp)2168
Transcript length (bp)2064
Coding sequence length (bp)2064
Protein length (aa) 688

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 2.7E-38 150 627
PF00083 Sugar_tr Sugar (and other) transporter 1.1E-09 167 311

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 44 681 1.0E-45
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 100 680 4.0E-42
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 78 609 1.0E-32
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 120 609 2.0E-22
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 85 351 2.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94343|YHMA_SCHPO Uncharacterized MFS-type transporter C1271.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1271.10c PE=1 SV=1 44 681 1.0E-45
sp|P53389|HOL1_YEAST Protein HOL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HOL1 PE=1 SV=1 100 680 4.0E-42
sp|Q59XM0|QDR3_CANAL MFS antiporter QDR3 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR3 PE=2 SV=1 78 609 1.0E-32
sp|P38227|QDR3_YEAST Quinidine resistance protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR3 PE=1 SV=2 120 609 2.0E-22
sp|P32071|CYHR_CANMA Cycloheximide resistance protein OS=Candida maltosa GN=CYHR PE=3 SV=1 85 351 2.0E-18
sp|P53943|AQR1_YEAST Probable transporter AQR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AQR1 PE=1 SV=1 127 328 8.0E-18
sp|O94528|CAF5_SCHPO Caffeine resistance protein 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=caf5 PE=3 SV=1 100 309 8.0E-17
sp|Q10487|MFS1_SCHPO Transporter mfs1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs1 PE=3 SV=1 88 309 1.0E-16
sp|Q06451|TPO3_YEAST Polyamine transporter 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO3 PE=1 SV=1 83 333 1.0E-15
sp|O59814|YCT4_SCHPO Uncharacterized transporter C794.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC794.04c PE=3 SV=1 62 309 2.0E-15
sp|P40475|QDR1_YEAST Quinidine resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR1 PE=1 SV=1 137 328 2.0E-14
sp|P53283|TPO2_YEAST Polyamine transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO2 PE=1 SV=1 88 333 3.0E-14
sp|O59738|YN22_SCHPO Uncharacterized transporter C530.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.02 PE=3 SV=1 68 312 6.0E-14
sp|Q7Z9I0|YHA8_SCHPO Uncharacterized MFS-type transporter C409.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC409.08 PE=3 SV=1 63 310 2.0E-13
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 110 310 6.0E-13
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 110 310 6.0E-13
sp|O74899|YQEH_SCHPO Uncharacterized transporter C576.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC576.17c PE=1 SV=1 97 309 1.0E-12
sp|Q12256|TPO4_YEAST Polyamine transporter 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO4 PE=1 SV=1 95 340 1.0E-12
sp|P40474|QDR2_YEAST Quinidine resistance protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=QDR2 PE=1 SV=1 137 328 1.0E-12
sp|Q9P3V5|YI45_SCHPO Uncharacterized transporter C1348.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1348.05 PE=3 SV=1 481 675 3.0E-12
sp|Q9P3E8|YLZ2_SCHPO Uncharacterized transporter C750.02c/PB2B2.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC750.02c PE=3 SV=1 481 675 6.0E-12
sp|Q5A6P6|QDR1_CANAL MFS antiporter QDR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR PE=2 SV=1 147 328 8.0E-12
sp|P28873|BMRP_CANAX Benomyl/methotrexate resistance protein OS=Candida albicans GN=MDR1 PE=3 SV=1 115 322 1.0E-11
sp|Q5ABU7|MDR1_CANAL Multidrug resistance protein 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MDR1 PE=1 SV=1 115 322 1.0E-11
sp|Q10084|MFS2_SCHPO Uncharacterized transporter mfs2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfs2 PE=3 SV=1 78 312 1.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 84 310 2.0E-11
sp|P38124|FLR1_YEAST Fluconazole resistance protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FLR1 PE=1 SV=1 114 309 3.0E-11
sp|Q9USN4|YJA1_SCHPO Uncharacterized transporter C1529.01 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1529.01 PE=3 SV=2 403 636 5.0E-11
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 73 333 6.0E-11
sp|O74829|YN2F_SCHPO Uncharacterized MFS-type transporter C530.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC530.15c PE=1 SV=2 116 336 2.0E-10
sp|O59698|YN41_SCHPO Uncharacterized transporter C36.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.01c PE=1 SV=1 20 347 3.0E-10
sp|P39386|MDTM_ECOLI Multidrug resistance protein MdtM OS=Escherichia coli (strain K12) GN=mdtM PE=1 SV=1 147 309 4.0E-10
sp|Q8XB84|MDTM_ECO57 Multidrug resistance protein MdtM OS=Escherichia coli O157:H7 GN=mdtM PE=3 SV=1 147 309 1.0E-09
sp|Q59YT1|QDR2_CANAL MFS antiporter QDR2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=QDR2 PE=3 SV=1 161 309 1.0E-09
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 502 675 7.0E-09
sp|G2TRN8|YI74_SCHPO Putative uncharacterized transporter C977.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.04 PE=5 SV=1 540 675 1.0E-08
sp|Q07824|TPO1_YEAST Polyamine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TPO1 PE=1 SV=1 81 336 3.0E-08
sp|Q7CP73|MDTM_SALTY Multidrug resistance protein MdtM OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mdtM PE=3 SV=1 147 309 3.0E-08
sp|Q8XFG0|MDTM_SALTI Multidrug resistance protein MdtM OS=Salmonella typhi GN=mdtM PE=3 SV=1 147 309 3.0E-08
sp|O59699|YN42_SCHPO Uncharacterized transporter C36.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.02c PE=3 SV=1 88 310 5.0E-08
sp|Q9HDX4|MFC1_SCHPO Uncharacterized transporter mfc1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mfc1 PE=3 SV=2 110 349 6.0E-08
sp|P38776|YHK8_YEAST Probable drug/proton antiporter YHK8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YHK8 PE=1 SV=1 498 675 3.0E-07
sp|P28246|BCR_ECOLI Bicyclomycin resistance protein OS=Escherichia coli (strain K12) GN=bcr PE=1 SV=4 157 309 6.0E-07
sp|P38125|DTR1_YEAST Dityrosine transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DTR1 PE=1 SV=1 157 332 7.0E-07
sp|P33532|BSU1_SCHPO Vitamin B6 transporter bsu1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bsu1 PE=3 SV=2 156 322 1.0E-06
sp|O35018|LMRB_BACSU Lincomycin resistance protein LmrB OS=Bacillus subtilis (strain 168) GN=lmrB PE=3 SV=1 154 289 1.0E-06
sp|P45123|BCR_HAEIN Bicyclomycin resistance protein homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=bcr PE=3 SV=1 154 330 2.0E-06
sp|O59833|YCUD_SCHPO Uncharacterized transporter C965.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC965.13 PE=3 SV=1 75 309 2.0E-06
sp|B5YXB4|MDTL_ECO5E Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=mdtL PE=3 SV=1 153 328 3.0E-06
sp|Q8XB24|MDTL_ECO57 Multidrug resistance protein MdtL OS=Escherichia coli O157:H7 GN=mdtL PE=3 SV=1 153 328 3.0E-06
sp|Q8Y9K8|LMRB_LISMO Lincomycin resistance protein LmrB OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmrB PE=3 SV=1 154 289 3.0E-06
sp|Q92EE1|LMRB_LISIN Lincomycin resistance protein LmrB OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=lmrB PE=3 SV=1 154 289 4.0E-06
sp|B5QUQ6|MDTL_SALEP Multidrug resistance protein MdtL OS=Salmonella enteritidis PT4 (strain P125109) GN=mdtL PE=3 SV=1 153 340 4.0E-06
sp|B5FN15|MDTL_SALDC Multidrug resistance protein MdtL OS=Salmonella dublin (strain CT_02021853) GN=mdtL PE=3 SV=1 153 340 4.0E-06
sp|C0Q2L5|MDTL_SALPC Multidrug resistance protein MdtL OS=Salmonella paratyphi C (strain RKS4594) GN=mdtL PE=3 SV=1 153 340 5.0E-06
sp|Q57HZ5|MDTL_SALCH Multidrug resistance protein MdtL OS=Salmonella choleraesuis (strain SC-B67) GN=mdtL PE=3 SV=1 153 340 5.0E-06
sp|O43081|YHS6_SCHPO Uncharacterized MFS-type transporter C947.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC947.06c PE=3 SV=1 98 310 7.0E-06
sp|O59700|YN43_SCHPO Uncharacterized transporter C36.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC36.03c PE=3 SV=1 119 322 8.0E-06
sp|Q1R4M4|MDTL_ECOUT Multidrug resistance protein MdtL OS=Escherichia coli (strain UTI89 / UPEC) GN=mdtL PE=3 SV=1 153 328 9.0E-06
sp|A1AHP3|MDTL_ECOK1 Multidrug resistance protein MdtL OS=Escherichia coli O1:K1 / APEC GN=mdtL PE=3 SV=1 153 328 9.0E-06
sp|B7MGD1|MDTL_ECO45 Multidrug resistance protein MdtL OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=mdtL PE=3 SV=1 153 328 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

Domain # Start End Length
1 133 155 22
2 170 192 22
3 199 216 17
4 231 250 19
5 257 279 22
6 284 306 22
7 466 488 22
8 508 530 22
9 551 573 22
10 583 605 22
11 617 639 22
12 649 671 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6705
MSSPSSPASWKLPTAIVRRLSSAWQGSSTNKSGRPKWSMGVLNDKETDEVPGSVLLLASSERNEPLGLGNIRART
SHSSLPTGLERPQSSRPPLEPIDEKKTTSDGAIILEPQPDDSANDPLNWPGWRRDTALLSLGFYCMIGGGITPLI
AAGFTDVARDFHVDVERVSLTTGLYMMGLGLGSVLASPTAILFGKRPVYLGSAIVFIATCLWAAWSPSFPSLLAA
RVFQGIAISPVECLPSATIAEIFFLHERAYRIGIYTLLLLGGKNLVPLVSAAIISRFGWRWVFWTVAAIVGLGFV
LLFLFVPETFWDRTPTKRPSNRPSLLNRLSSRLAVHRLATGGSSSSRALPSPGAAARHSDLHVGFVEPQTPDWVV
PPSPHQLDQQTCYFRHVRDDSADNSSYAARAPPSLDMEKMTASALAASPKTQAYTHNLRQQPAQTFVQQLRPFHG
RLNNDKWFKVMLRPFVLFAYPSVLWSAAVYSCSIGWLIVISETMAVIYRDPTMYNFSALQTGLVYISPFIGGILG
TGVAGKVSDVIVRAMSRRNGGLYEPEFRLVMVIPVLLSTCIGLMGFGWSAQKKDPWIVPTIFFGILSFGCSLGST
TSITYCVDSYRQYAGEALVTLNFAKNICHGLVFSLFVAHWMAEDGPRLVYIWLGVIQVLVLLTTVPMYIYGKRAR
MWTARRNLMEKF*
Coding >Ophun1|6705
ATGTCGTCTCCGTCGTCACCTGCCAGCTGGAAGCTGCCCACGGCCATCGTAAGGCGGCTGTCTTCGGCATGGCAG
GGCTCCTCGACCAACAAGTCGGGTCGTCCCAAGTGGAGCATGGGCGTCCTCAACGACAAGGAGACGGACGAGGTT
CCCGGTTCCGTCCTGCTGCTGGCCTCGTCGGAGCGCAACGAGCCGCTGGGGCTGGGCAATATACGGGCGCGGACA
TCGCACTCGTCGCTCCCAACGGGTCTGGAAAGGCCGCAGTCATCGCGACCGCCGCTCGAGCCCATCGATGAGAAG
AAGACGACGAGCGATGGCGCCATCATCCTCGAGCCCCAGCCCGACGACTCGGCCAACGACCCGCTCAACTGGCCC
GGCTGGCGACGAGACACAGCCCTGCTGTCCCTGGGCTTCTACTGCATGATTGGGGGCGGCATCACGCCCCTCATC
GCCGCCGGCTTCACCGACGTGGCGCGCGACTTCCATGTCGACGTCGAGCGCGTTTCCCTTACCACGGGTCTCTAC
ATGATGGGTCTTGGTCTGGGATCCGTTCTCGCGTCTCCCACAGCCATATTGTTCGGGAAACGACCCGTCTACCTT
GGTAGCGCCATCGTCTTCATCGCCACCTGTCTGTGGGCGGCATGGTCACCCAGCTTTCCGTCCCTGCTGGCGGCC
CGCGTCTTCCAGGGCATCGCCATCAGCCCGGTCGAGTGCCTGCCGTCGGCCACGATTGCCGAGATTTTCTTCCTG
CACGAGCGCGCCTATCGGATCGGCATCTATACCCTACTGCTGCTGGGCGGCAAGAACCTGGTGCCGCTGGTGAGC
GCCGCCATCATCAGCCGCTTTGGCTGGCGCTGGGTGTTTTGGACCGTGGCTGCCATCGTCGGCCTCGGCTTCGTC
CTCCTCTTCCTCTTCGTCCCGGAGACGTTTTGGGATCGGACGCCGACCAAGAGACCGTCGAACCGACCGAGTCTG
CTGAACCGGCTATCGTCGCGTCTGGCCGTTCATCGGCTGGCCACAGGCGGCAGCAGCAGCAGCAGGGCCCTCCCG
TCGCCCGGAGCGGCGGCCCGCCACAGCGACCTCCACGTCGGCTTCGTCGAGCCCCAGACGCCCGACTGGGTGGTC
CCCCCTTCGCCGCACCAGCTGGACCAGCAGACGTGCTACTTCCGGCACGTCCGCGACGACAGCGCCGACAACAGC
TCGTACGCGGCCAGGGCGCCCCCCAGCCTCGACATGGAGAAGATGACGGCCTCGGCCCTGGCGGCGTCGCCCAAG
ACGCAGGCCTACACGCATAACCTGCGTCAGCAGCCGGCGCAGACGTTTGTCCAGCAGCTCAGGCCCTTCCACGGC
CGGCTCAACAACGACAAGTGGTTCAAGGTGATGCTGCGGCCCTTTGTCCTGTTCGCCTACCCGTCGGTGCTGTGG
TCGGCGGCCGTCTACTCGTGCTCCATCGGCTGGCTCATCGTCATCTCGGAGACGATGGCCGTCATCTACCGCGAC
CCGACCATGTACAACTTCTCGGCGCTGCAGACGGGTCTCGTCTACATCTCGCCCTTTATCGGCGGTATCCTGGGC
ACGGGCGTGGCCGGCAAGGTCAGCGACGTCATCGTACGGGCCATGTCACGTCGCAACGGGGGCCTGTACGAGCCC
GAGTTCCGGCTGGTCATGGTGATTCCCGTCTTGCTGTCGACGTGCATAGGGCTCATGGGCTTCGGCTGGTCGGCC
CAGAAGAAGGATCCGTGGATCGTGCCGACCATCTTCTTTGGCATCCTGTCGTTTGGCTGCTCGCTGGGGTCGACG
ACGTCGATTACCTACTGCGTCGACAGCTACCGTCAGTACGCGGGCGAAGCTCTCGTGACGCTCAACTTTGCCAAG
AACATCTGCCACGGCCTCGTCTTTAGCCTGTTTGTCGCCCACTGGATGGCCGAGGACGGGCCGAGGCTGGTGTAT
ATCTGGCTGGGCGTCATCCAGGTGCTGGTGCTGCTGACGACGGTTCCCATGTATATATACGGGAAGAGGGCGCGC
ATGTGGACGGCGAGGCGGAATCTTATGGAGAAGTTTTGA
Transcript >Ophun1|6705
ATGTCGTCTCCGTCGTCACCTGCCAGCTGGAAGCTGCCCACGGCCATCGTAAGGCGGCTGTCTTCGGCATGGCAG
GGCTCCTCGACCAACAAGTCGGGTCGTCCCAAGTGGAGCATGGGCGTCCTCAACGACAAGGAGACGGACGAGGTT
CCCGGTTCCGTCCTGCTGCTGGCCTCGTCGGAGCGCAACGAGCCGCTGGGGCTGGGCAATATACGGGCGCGGACA
TCGCACTCGTCGCTCCCAACGGGTCTGGAAAGGCCGCAGTCATCGCGACCGCCGCTCGAGCCCATCGATGAGAAG
AAGACGACGAGCGATGGCGCCATCATCCTCGAGCCCCAGCCCGACGACTCGGCCAACGACCCGCTCAACTGGCCC
GGCTGGCGACGAGACACAGCCCTGCTGTCCCTGGGCTTCTACTGCATGATTGGGGGCGGCATCACGCCCCTCATC
GCCGCCGGCTTCACCGACGTGGCGCGCGACTTCCATGTCGACGTCGAGCGCGTTTCCCTTACCACGGGTCTCTAC
ATGATGGGTCTTGGTCTGGGATCCGTTCTCGCGTCTCCCACAGCCATATTGTTCGGGAAACGACCCGTCTACCTT
GGTAGCGCCATCGTCTTCATCGCCACCTGTCTGTGGGCGGCATGGTCACCCAGCTTTCCGTCCCTGCTGGCGGCC
CGCGTCTTCCAGGGCATCGCCATCAGCCCGGTCGAGTGCCTGCCGTCGGCCACGATTGCCGAGATTTTCTTCCTG
CACGAGCGCGCCTATCGGATCGGCATCTATACCCTACTGCTGCTGGGCGGCAAGAACCTGGTGCCGCTGGTGAGC
GCCGCCATCATCAGCCGCTTTGGCTGGCGCTGGGTGTTTTGGACCGTGGCTGCCATCGTCGGCCTCGGCTTCGTC
CTCCTCTTCCTCTTCGTCCCGGAGACGTTTTGGGATCGGACGCCGACCAAGAGACCGTCGAACCGACCGAGTCTG
CTGAACCGGCTATCGTCGCGTCTGGCCGTTCATCGGCTGGCCACAGGCGGCAGCAGCAGCAGCAGGGCCCTCCCG
TCGCCCGGAGCGGCGGCCCGCCACAGCGACCTCCACGTCGGCTTCGTCGAGCCCCAGACGCCCGACTGGGTGGTC
CCCCCTTCGCCGCACCAGCTGGACCAGCAGACGTGCTACTTCCGGCACGTCCGCGACGACAGCGCCGACAACAGC
TCGTACGCGGCCAGGGCGCCCCCCAGCCTCGACATGGAGAAGATGACGGCCTCGGCCCTGGCGGCGTCGCCCAAG
ACGCAGGCCTACACGCATAACCTGCGTCAGCAGCCGGCGCAGACGTTTGTCCAGCAGCTCAGGCCCTTCCACGGC
CGGCTCAACAACGACAAGTGGTTCAAGGTGATGCTGCGGCCCTTTGTCCTGTTCGCCTACCCGTCGGTGCTGTGG
TCGGCGGCCGTCTACTCGTGCTCCATCGGCTGGCTCATCGTCATCTCGGAGACGATGGCCGTCATCTACCGCGAC
CCGACCATGTACAACTTCTCGGCGCTGCAGACGGGTCTCGTCTACATCTCGCCCTTTATCGGCGGTATCCTGGGC
ACGGGCGTGGCCGGCAAGGTCAGCGACGTCATCGTACGGGCCATGTCACGTCGCAACGGGGGCCTGTACGAGCCC
GAGTTCCGGCTGGTCATGGTGATTCCCGTCTTGCTGTCGACGTGCATAGGGCTCATGGGCTTCGGCTGGTCGGCC
CAGAAGAAGGATCCGTGGATCGTGCCGACCATCTTCTTTGGCATCCTGTCGTTTGGCTGCTCGCTGGGGTCGACG
ACGTCGATTACCTACTGCGTCGACAGCTACCGTCAGTACGCGGGCGAAGCTCTCGTGACGCTCAACTTTGCCAAG
AACATCTGCCACGGCCTCGTCTTTAGCCTGTTTGTCGCCCACTGGATGGCCGAGGACGGGCCGAGGCTGGTGTAT
ATCTGGCTGGGCGTCATCCAGGTGCTGGTGCTGCTGACGACGGTTCCCATGTATATATACGGGAAGAGGGCGCGC
ATGTGGACGGCGAGGCGGAATCTTATGGAGAAGTTTTGA
Gene >Ophun1|6705
ATGTCGTCTCCGTCGTCACCTGCCAGCTGGAAGCTGCCCACGGCCATCGTAAGGCGGCTGTCTTCGGCATGGCAG
GGCTCCTCGACCAACAAGTCGGGTCGTCCCAAGTGGAGCATGGGCGTCCTCAACGACAAGGAGACGGACGAGGTT
CCCGGTACGCTGAATGGATGGCTTGGCGGAGACGAGGCTGACTGACGTCTTTTTAGGTTCCGTCCTGCTGCTGGC
CTCGTCGGAGCGCAACGAGCCGCTGGGGCTGGGCAATATACGGGCGCGGACATCGCACTCGTCGCTCCCAACGGG
TCTGGAAAGGCCGCAGTCATCGCGACCGCCGCTCGAGCCCATCGATGAGAAGAAGACGACGAGCGATGGCGCCAT
CATCCTCGAGCCCCAGCCCGACGACTCGGCCAACGACCCGCTCAACTGGCCCGGCTGGCGACGAGACACAGCCCT
GCTGTCCCTGGGCTTCTACTGCATGATTGGGGGCGGCATCACGCCCCTCATCGCCGCCGGCTTCACCGACGTGGC
GCGCGACTTCCATGTCGACGTCGAGCGCGTTTCCCTTACCACGGGTCTCTACATGATGGGTCTTGGTCTGGGATC
CGTTCTCGCGTCTCCCACAGCCATATTGTTCGGGAAACGACCCGTCTACCTTGGTAGCGCCATCGTCTTCATCGC
CACCTGTCTGTGGGCGGCATGGTCACCCAGCTTTCCGTCCCTGCTGGCGGCCCGCGTCTTCCAGGGCATCGCCAT
CAGCCCGGTCGAGTGCCTGCCGTCGGCCACGATTGCCGAGATTTTCTTCCTGCACGAGCGCGCCTATCGGATCGG
CATCTATACCCTACTGCTGCTGGGCGGCAAGAACCTGGTGCCGCTGGTGAGCGCCGCCATCATCAGCCGCTTTGG
CTGGCGCTGGGTGTTTTGGTGCGTTGTCTGCGTCGCCTCTACGGGCTCGATTCTGACAGACAAAATGCAGGACCG
TGGCTGCCATCGTCGGCCTCGGCTTCGTCCTCCTCTTCCTCTTCGTCCCGGAGACGTTTTGGGATCGGACGCCGA
CCAAGAGACCGTCGAACCGACCGAGTCTGCTGAACCGGCTATCGTCGCGTCTGGCCGTTCATCGGCTGGCCACAG
GCGGCAGCAGCAGCAGCAGGGCCCTCCCGTCGCCCGGAGCGGCGGCCCGCCACAGCGACCTCCACGTCGGCTTCG
TCGAGCCCCAGACGCCCGACTGGGTGGTCCCCCCTTCGCCGCACCAGCTGGACCAGCAGACGTGCTACTTCCGGC
ACGTCCGCGACGACAGCGCCGACAACAGCTCGTACGCGGCCAGGGCGCCCCCCAGCCTCGACATGGAGAAGATGA
CGGCCTCGGCCCTGGCGGCGTCGCCCAAGACGCAGGCCTACACGCATAACCTGCGTCAGCAGCCGGCGCAGACGT
TTGTCCAGCAGCTCAGGCCCTTCCACGGCCGGCTCAACAACGACAAGTGGTTCAAGGTGATGCTGCGGCCCTTTG
TCCTGTTCGCCTACCCGTCGGTGCTGTGGTCGGCGGCCGTCTACTCGTGCTCCATCGGCTGGCTCATCGTCATCT
CGGAGACGATGGCCGTCATCTACCGCGACCCGACCATGTACAACTTCTCGGCGCTGCAGACGGGTCTCGTCTACA
TCTCGCCCTTTATCGGCGGTATCCTGGGCACGGGCGTGGCCGGCAAGGTCAGCGACGTCATCGTACGGGCCATGT
CACGTCGCAACGGGGGCCTGTACGAGCCCGAGTTCCGGCTGGTCATGGTGATTCCCGTCTTGCTGTCGACGTGCA
TAGGGCTCATGGGCTTCGGCTGGTCGGCCCAGAAGAAGGATCCGTGGATCGTGCCGACCATCTTCTTTGGCATCC
TGTCGTTTGGCTGCTCGCTGGGGTCGACGACGTCGATTACCTACTGCGTCGACAGCTACCGTCAGTACGCGGGCG
AAGCTCTCGTGACGCTCAACTTTGCCAAGAACATCTGCCACGGCCTCGTCTTTAGCCTGTTTGTCGCCCACTGGA
TGGCCGAGGACGGGCCGAGGCTGGTGTATATCTGGCTGGGCGTCATCCAGGTGCTGGTGCTGCTGACGACGGTTC
CCATGTATATATACGGGAAGAGGGCGCGCATGTGGACGGCGAGGCGGAATCTTATGGAGAAGTTTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail