Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|67
Gene name
LocationContig_10:19722..21134
Strand-
Gene length (bp)1412
Transcript length (bp)975
Coding sequence length (bp)975
Protein length (aa) 325

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF19086 Terpene_syn_C_2 Terpene synthase family 2, C-terminal metal binding 5.5E-26 91 274

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q6WP50|BOT2_BOTFU Presilphiperfolan-8-beta-ol synthase OS=Botryotinia fuckeliana GN=BOT2 PE=1 SV=1 178 320 4.0E-10
sp|B2J4A4|GERAS_NOSP7 Germacrene A synthase OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=Npun_R3832 PE=1 SV=1 48 321 2.0E-08
sp|A8NE23|COP3_COPC7 Alpha-muurolene synthase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=COP3 PE=1 SV=1 147 320 2.0E-08
sp|D8RNZ9|MTS22_SELML (3S,6E)-nerolidol synthase OS=Selaginella moellendorffii GN=SELMODRAFT_413294 PE=1 SV=1 50 321 1.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|67
MPSPRQELLQRLREQHVQLPDLQLLFSDWPQPAVSPGLDEMRPVISAALRSKLADRPTQHKVLDKMDVGLFTATY
WPNTTLHQGLTLACIVIWLWVWDDDARVAKQIDQVARCFRVTDAAQQPATNTYQDFLTTIGNEIGDTHDFETRQL
FLSEFKFTLESISLEQRRRLSPMLPTPEEYMATRMGTSAVNLASLLNCFANGFTLPLKVLTDPDMSVLLDQTNII
IWALNDLISLEKEIKEKAIDSLVPLLYHQSGNFEDAVTQVIGIVKKAIRHFDLVAATLANKFKDEAVAGNLCRFV
DACRKNCTGSLYWSLRTRRYRLAK*
Coding >Ophun1|67
ATGCCATCTCCAAGACAGGAGCTCCTTCAACGCCTCCGTGAGCAGCATGTTCAGCTCCCCGACCTGCAGCTTCTC
TTCTCAGACTGGCCCCAGCCGGCGGTCAGCCCGGGACTCGATGAGATGAGACCTGTCATTTCAGCTGCTCTCAGA
AGTAAACTCGCCGACCGACCAACTCAGCACAAGGTGTTGGACAAGATGGATGTAGGGCTCTTCACGGCGACATAC
TGGCCCAACACGACGTTGCATCAAGGGTTGACGTTGGCTTGCATTGTCATATGGCTTTGGGTTTGGGACGACGAT
GCTCGTGTTGCAAAACAGATTGATCAAGTCGCACGATGCTTTCGTGTCACGGATGCCGCCCAACAGCCCGCGACA
AACACATATCAAGACTTTCTAACGACCATCGGCAACGAGATTGGCGACACCCACGACTTTGAAACCCGGCAGCTC
TTCCTGTCAGAGTTCAAGTTTACTCTCGAGTCCATCTCGCTGGAACAGAGGCGTCGCCTGAGCCCGATGCTACCT
ACCCCTGAAGAGTACATGGCGACGAGGATGGGGACCAGTGCAGTCAACCTGGCTTCCCTTCTCAACTGCTTCGCG
AATGGCTTCACGCTGCCCCTGAAGGTCTTGACGGATCCGGATATGAGTGTGTTGCTAGACCAAACCAACATTATC
ATCTGGGCCTTGAACGATCTCATCTCTCTCGAGAAAGAGATTAAGGAAAAGGCAATCGACAGCCTCGTTCCCTTG
CTCTACCACCAGAGCGGCAACTTTGAAGATGCCGTTACCCAAGTTATCGGCATCGTCAAGAAAGCCATCCGACAT
TTCGATCTCGTCGCAGCTACCCTGGCTAACAAGTTTAAGGACGAAGCTGTGGCAGGGAACTTGTGTCGTTTTGTC
GATGCGTGCCGCAAGAACTGCACGGGAAGCTTGTATTGGAGTCTTCGTACACGTCGCTATCGTCTTGCCAAGTAG
Transcript >Ophun1|67
ATGCCATCTCCAAGACAGGAGCTCCTTCAACGCCTCCGTGAGCAGCATGTTCAGCTCCCCGACCTGCAGCTTCTC
TTCTCAGACTGGCCCCAGCCGGCGGTCAGCCCGGGACTCGATGAGATGAGACCTGTCATTTCAGCTGCTCTCAGA
AGTAAACTCGCCGACCGACCAACTCAGCACAAGGTGTTGGACAAGATGGATGTAGGGCTCTTCACGGCGACATAC
TGGCCCAACACGACGTTGCATCAAGGGTTGACGTTGGCTTGCATTGTCATATGGCTTTGGGTTTGGGACGACGAT
GCTCGTGTTGCAAAACAGATTGATCAAGTCGCACGATGCTTTCGTGTCACGGATGCCGCCCAACAGCCCGCGACA
AACACATATCAAGACTTTCTAACGACCATCGGCAACGAGATTGGCGACACCCACGACTTTGAAACCCGGCAGCTC
TTCCTGTCAGAGTTCAAGTTTACTCTCGAGTCCATCTCGCTGGAACAGAGGCGTCGCCTGAGCCCGATGCTACCT
ACCCCTGAAGAGTACATGGCGACGAGGATGGGGACCAGTGCAGTCAACCTGGCTTCCCTTCTCAACTGCTTCGCG
AATGGCTTCACGCTGCCCCTGAAGGTCTTGACGGATCCGGATATGAGTGTGTTGCTAGACCAAACCAACATTATC
ATCTGGGCCTTGAACGATCTCATCTCTCTCGAGAAAGAGATTAAGGAAAAGGCAATCGACAGCCTCGTTCCCTTG
CTCTACCACCAGAGCGGCAACTTTGAAGATGCCGTTACCCAAGTTATCGGCATCGTCAAGAAAGCCATCCGACAT
TTCGATCTCGTCGCAGCTACCCTGGCTAACAAGTTTAAGGACGAAGCTGTGGCAGGGAACTTGTGTCGTTTTGTC
GATGCGTGCCGCAAGAACTGCACGGGAAGCTTGTATTGGAGTCTTCGTACACGTCGCTATCGTCTTGCCAAGTAG
Gene >Ophun1|67
ATGCCATCTCCAAGACAGGAGCTCCTTCAACGCCTCCGTGAGCAGCATGTTCAGCTCCCCGACCTGCAGCTTCTC
TTCTCAGACTGGCCCCAGCCGGCGGTCAGCCCGGGACTCGATGAGATGAGACCTGTCATTTCAGCTGCTCTCAGA
AGGTTCGCTTCCTGCACACCGGCTGGTGCTGCATGCGGCTAAGCACATACTCAGTAAACTCGCCGACCGACCAAC
TCAGCACAAGGTGTTGGACAAGATGGATGTAGGGCTCTTCACGGCGACATACTGGCCCAACACGACGTTGCATCA
AGGGTTGACGTTGGCTTGCATTGTCATATGGGTGCGTTTCGTAGACCACAAGACTTTAGTTCTTAACGCTCATCT
TGTCCAGCTTTGGGTTTGGGACGACGGTACGTCTGAGATTGATGCAGGAACAAACAGGGGACTGGAGATGAAACA
GTTGATTACAACTTCGATTGCATGTAGAAGCCGAAAACGAAACACTTTCGGCAGACTCAACAGCGGCAGATGCTC
GTGTTGCAAAACAGATTGATCAAGTCGCACGATGCTTTCGTGTCACGGATGCCGCCCAACAGCCCGCGACAAACA
CATATCAAGACTTTCTAACGACCATCGGCAACGAGATTGGCGACACCCACGACTTTGGTATGTATATCCTCCCAG
AATCGACATTCATAGGCTAACGACAAACCGCGCCGCCGACAGAAACCCGGCAGCTCTTCCTGTCAGAGTTCAAGT
TTACTCTCGAGTCCATCTCGCTGGAACAGAGGCGTCGCCTGAGCCCGATGCTACCTACCCCTGAAGAGTACATGG
CGACGAGGATGGGGACCAGTGCAGTCAACCTGGCTTCCCTTCTCAACTGGTCTGTCTACCATCTGTCCTGTCTCA
ACCCGCTGAGTTGTTTCTAAGTCGAAAGCTTCGCGAATGGCTTCACGCTGCCCCTGAAGGTCTTGACGGATCCGG
ATATGAGTGTGTTGCTAGACCAAACCAACATTATCATCTGGGCGTGAGTTCAAGATCCGATCAACCAGCGGCAAT
TCCTGAACTGAGCATTCCAGCTTGAACGATCTCATCTCTCTCGAGAAAGAGATTGTGAGCAATACAACCGCAGCA
GCACGATTATGGCGGCTAACCGGTCCCAGAAGGAAAAGGCAATCGACAGCCTCGTTCCCTTGCTCTACCACCAGA
GCGGCAACTTTGAAGATGCCGTTACCCAAGTTATCGGCATCGTCAAGAAAGCCATCCGACATTTCGATCTCGTCG
CAGCTACCCTGGCTAACAAGTTTAAGGACGAAGCTGTGGCAGGGAACTTGTGTCGTTTTGTCGATGCGTGCCGCA
AGAACTGCACGGGAAGCTTGTATTGGAGTCTTCGTACACGTCGCTATCGTCTTGCCAAGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail