Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6699
Gene name
LocationContig_757:5..1555
Strand-
Gene length (bp)1550
Transcript length (bp)1263
Coding sequence length (bp)1263
Protein length (aa) 421

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00132 Hexapep Bacterial transferase hexapeptide (six repeats) 2.1E-07 312 345
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 8.9E-03 314 344
PF14602 Hexapep_2 Hexapeptide repeat of succinyl-transferase 2.4E-01 355 383

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 23 405 1.0E-89
sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 23 403 2.0E-88
sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1 23 403 3.0E-76
sp|Q54RF3|EI2BE_DICDI Translation initiation factor eIF-2B subunit epsilon OS=Dictyostelium discoideum GN=eif2b5 PE=3 SV=1 23 396 9.0E-75
sp|P47823|EI2BE_RABIT Translation initiation factor eIF-2B subunit epsilon OS=Oryctolagus cuniculus GN=EIF2B5 PE=1 SV=1 24 410 7.0E-68
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P56287|EI2BE_SCHPO Probable translation initiation factor eIF-2B subunit epsilon OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif225 PE=1 SV=1 23 405 1.0E-89
sp|P87163|EI2BE_CANAL Translation initiation factor eIF-2B subunit epsilon OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=GCD6 PE=3 SV=2 23 403 2.0E-88
sp|P32501|EI2BE_YEAST Translation initiation factor eIF-2B subunit epsilon OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GCD6 PE=1 SV=1 23 403 3.0E-76
sp|Q54RF3|EI2BE_DICDI Translation initiation factor eIF-2B subunit epsilon OS=Dictyostelium discoideum GN=eif2b5 PE=3 SV=1 23 396 9.0E-75
sp|P47823|EI2BE_RABIT Translation initiation factor eIF-2B subunit epsilon OS=Oryctolagus cuniculus GN=EIF2B5 PE=1 SV=1 24 410 7.0E-68
sp|Q13144|EI2BE_HUMAN Translation initiation factor eIF-2B subunit epsilon OS=Homo sapiens GN=EIF2B5 PE=1 SV=3 24 407 7.0E-68
sp|Q64350|EI2BE_RAT Translation initiation factor eIF-2B subunit epsilon OS=Rattus norvegicus GN=Eif2b5 PE=1 SV=2 24 410 8.0E-68
sp|Q8CHW4|EI2BE_MOUSE Translation initiation factor eIF-2B subunit epsilon OS=Mus musculus GN=Eif2b5 PE=1 SV=1 24 410 6.0E-66
sp|P37820|MPG1_SULAC Putative mannose-1-phosphate guanyltransferase OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=mpg1 PE=3 SV=2 22 402 2.0E-10
sp|Q54FQ8|EI2BG_DICDI Translation initiation factor eIF-2B subunit gamma OS=Dictyostelium discoideum GN=eif2b3 PE=3 SV=1 250 372 4.0E-10
sp|A5PJI7|EI2BG_BOVIN Translation initiation factor eIF-2B subunit gamma OS=Bos taurus GN=EIF2B3 PE=2 SV=1 244 389 4.0E-07
sp|P56288|EI2BG_SCHPO Probable translation initiation factor eIF-2B subunit gamma OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tif223 PE=1 SV=2 302 373 3.0E-06
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1698
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7806
Ophiocordyceps australis map64 (Brazil) OphauB2|1833
Ophiocordyceps camponoti-floridani Ophcf2|03192
Ophiocordyceps camponoti-rufipedis Ophun1|6699 (this protein)
Ophiocordyceps kimflemingae Ophio5|407
Ophiocordyceps subramaniannii Hirsu2|1486

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6699
MSQKAKSSSKAKKPVKSGAETRPLLDYTLEFLAMNGVAEVFIYCGAHADQVEEYFGRSRWSTASHSNPFSLIQIV
RVSDARSSGDMLRDLDKRSLVEGDFILVHGDTVSNMMLDEALAAHRARREADAANIMTTVLRSGGDSSHRTKTNA
VTPVFVVDSHSRRILQYEETTPLQSGRYLALDPAIVDELSADFEVRSDLIDAQIDICTPEVLALWSESFDYELPR
AHFLHGVLKDWELNGKMVYADVLDDGYAARASDLQMYDAIGRDILGRWTCPLIPENNVAPAERYRWRADGLVVES
GAGLAPDGRLSNSIIGRDTTIGPDCTVSNSVIGRGCRIGAGVVVEDSFIWDDVTIEDETRIKHSILADSVVLGRN
CVVPAGSLLSTRVRVGHGVALNRTAVLSTLSPSGEPRRRRRRRRR*
Coding >Ophun1|6699
ATGTCGCAAAAGGCCAAGAGCTCGTCCAAGGCCAAGAAGCCCGTCAAGTCGGGCGCTGAGACCAGGCCGCTGCTC
GATTATACTCTCGAGTTCCTGGCCATGAATGGCGTCGCCGAAGTCTTTATATACTGCGGCGCGCACGCTGATCAG
GTGGAGGAATATTTTGGCCGCTCGCGCTGGTCGACGGCCTCGCACTCGAACCCCTTCTCGCTCATCCAGATCGTG
CGCGTCTCGGATGCCAGGTCAAGCGGCGATATGCTCCGCGACCTGGACAAGCGATCCCTCGTCGAGGGTGACTTC
ATTCTCGTACACGGCGATACCGTCTCCAACATGATGCTTGACGAAGCGCTGGCCGCCCATCGGGCCCGGCGAGAA
GCCGATGCGGCCAACATCATGACGACGGTGCTGCGCAGCGGCGGCGACAGCAGCCACCGCACAAAGACCAACGCC
GTCACGCCCGTCTTCGTCGTCGACTCCCACTCTCGACGAATCCTGCAATATGAAGAAACGACGCCACTTCAGAGT
GGTCGCTACCTCGCGCTCGACCCTGCCATCGTCGACGAACTGTCAGCCGACTTTGAGGTGCGTTCCGACCTCATC
GACGCCCAGATCGACATCTGCACCCCCGAGGTGCTCGCCCTCTGGTCCGAGAGTTTCGATTACGAGCTGCCGCGT
GCCCACTTTCTTCACGGAGTCCTCAAGGACTGGGAGCTCAACGGCAAGATGGTCTATGCCGATGTGCTCGACGAT
GGCTACGCAGCCCGCGCCAGCGACCTGCAGATGTATGACGCCATTGGCCGTGATATTCTCGGCCGCTGGACCTGT
CCCCTAATCCCGGAGAACAATGTTGCTCCAGCCGAGCGCTATCGGTGGCGCGCCGACGGTCTTGTCGTCGAGTCC
GGCGCCGGCCTCGCCCCGGACGGCCGTCTGTCCAACTCGATCATCGGGCGCGACACCACAATCGGCCCTGACTGC
ACCGTATCCAACAGTGTCATCGGCAGGGGCTGTCGCATTGGCGCCGGCGTCGTCGTCGAGGACTCATTCATATGG
GATGACGTGACGATCGAGGACGAGACCAGGATAAAGCACTCGATCCTAGCAGACTCAGTCGTGCTCGGCAGAAAC
TGCGTCGTCCCAGCCGGCTCCCTCCTTTCAACCCGAGTCCGCGTCGGTCACGGTGTAGCACTCAACCGGACCGCC
GTGCTTTCGACGCTCTCTCCCTCCGGCGAGCCGCGGCGACGGCGACGGCGACGACGACGATAG
Transcript >Ophun1|6699
ATGTCGCAAAAGGCCAAGAGCTCGTCCAAGGCCAAGAAGCCCGTCAAGTCGGGCGCTGAGACCAGGCCGCTGCTC
GATTATACTCTCGAGTTCCTGGCCATGAATGGCGTCGCCGAAGTCTTTATATACTGCGGCGCGCACGCTGATCAG
GTGGAGGAATATTTTGGCCGCTCGCGCTGGTCGACGGCCTCGCACTCGAACCCCTTCTCGCTCATCCAGATCGTG
CGCGTCTCGGATGCCAGGTCAAGCGGCGATATGCTCCGCGACCTGGACAAGCGATCCCTCGTCGAGGGTGACTTC
ATTCTCGTACACGGCGATACCGTCTCCAACATGATGCTTGACGAAGCGCTGGCCGCCCATCGGGCCCGGCGAGAA
GCCGATGCGGCCAACATCATGACGACGGTGCTGCGCAGCGGCGGCGACAGCAGCCACCGCACAAAGACCAACGCC
GTCACGCCCGTCTTCGTCGTCGACTCCCACTCTCGACGAATCCTGCAATATGAAGAAACGACGCCACTTCAGAGT
GGTCGCTACCTCGCGCTCGACCCTGCCATCGTCGACGAACTGTCAGCCGACTTTGAGGTGCGTTCCGACCTCATC
GACGCCCAGATCGACATCTGCACCCCCGAGGTGCTCGCCCTCTGGTCCGAGAGTTTCGATTACGAGCTGCCGCGT
GCCCACTTTCTTCACGGAGTCCTCAAGGACTGGGAGCTCAACGGCAAGATGGTCTATGCCGATGTGCTCGACGAT
GGCTACGCAGCCCGCGCCAGCGACCTGCAGATGTATGACGCCATTGGCCGTGATATTCTCGGCCGCTGGACCTGT
CCCCTAATCCCGGAGAACAATGTTGCTCCAGCCGAGCGCTATCGGTGGCGCGCCGACGGTCTTGTCGTCGAGTCC
GGCGCCGGCCTCGCCCCGGACGGCCGTCTGTCCAACTCGATCATCGGGCGCGACACCACAATCGGCCCTGACTGC
ACCGTATCCAACAGTGTCATCGGCAGGGGCTGTCGCATTGGCGCCGGCGTCGTCGTCGAGGACTCATTCATATGG
GATGACGTGACGATCGAGGACGAGACCAGGATAAAGCACTCGATCCTAGCAGACTCAGTCGTGCTCGGCAGAAAC
TGCGTCGTCCCAGCCGGCTCCCTCCTTTCAACCCGAGTCCGCGTCGGTCACGGTGTAGCACTCAACCGGACCGCC
GTGCTTTCGACGCTCTCTCCCTCCGGCGAGCCGCGGCGACGGCGACGGCGACGACGACGATAG
Gene >Ophun1|6699
ATGTCGCAAAAGGCCAAGAGCTCGTCCAAGGCCAAGAAGCCCGTCAAGTCGGGCGCTGAGACCAGGTCTGAACAG
CCTCTTCAGGCAGTTGTGCGTTGCTTCGCTTCTCTCACCTCTCGCTGGCTGCCGCCGTCGCTGACTAGAAACGCT
ACAGGTCCTCGCAGACTGCTTCCAGGACCGTTTCAAGCCTTTTTCTCTCGATAGACCAAGAGTATGCATGCAATC
CCTCTCTATTCCTGGCAACGTCATCTGAATATCTTCCCCAAGTGTCTACTTCCCCTCGCCAACAGGCCGCTGCTC
GATTATACTCTCGAGTTCCTGGCCATGAATGGCGTCGCCGAAGTCTTTATATACTGCGGCGCGCACGCTGATCAG
GTGGAGGAATATTTTGGCCGCTCGCGCTGGTCGACGGCCTCGCACTCGAACCCCTTCTCGCTCATCCAGATCGTG
CGCGTCTCGGATGCCAGGTCAAGCGGCGATATGCTCCGCGACCTGGACAAGCGATCCCTCGTCGAGGGTGACTTC
ATTCTCGTACACGGCGATACCGTCTCCAACATGATGCTTGACGAAGCGCTGGCCGCCCATCGGGCCCGGCGAGAA
GCCGATGCGGCCAACATCATGACGACGGTGCTGCGCAGCGGCGGCGACAGCAGCCACCGCACAAAGACCAACGCC
GTCACGCCCGTCTTCGTCGTCGACTCCCACTCTCGACGAATCCTGCAATATGAAGAAACGACGCCACTTCAGAGT
GGTCGCTACCTCGCGCTCGACCCTGCCATCGTCGACGAACTGTCAGCCGACTTTGAGGTGCGTTCCGACCTCATC
GACGCCCAGATCGACATCTGCACCCCCGAGGTGCTCGCCCTCTGGTCCGAGAGTTTCGATTACGAGCTGCCGCGT
GCCCACTTTCTTCACGGAGTCCTCAAGGACTGGGAGCTCAACGGCAAGATGGTCTATGCCGATGTGCTCGACGAT
GGCTACGCAGCCCGCGCCAGCGACCTGCAGATGTATGACGCCATTGGCCGTGATATTCTCGGCCGCTGGACCTGT
CCCCTAATCCCGGAGAACAATGTTGCTCCAGCCGAGCGCTATCGGTGGCGCGCCGACGGTCTTGTCGTCGAGTCC
GGCGCCGGCCTCGCCCCGGACGGCCGTCTGTCCAACTCGATCATCGGGCGCGACACCACAATCGGCCCTGACTGC
ACCGTATCCAACAGTGTCATCGGCAGGGGCTGTCGCATTGGCGCCGGCGTCGTCGTCGAGGACTCATTCATATGG
GATGACGTGACGATCGAGGACGAGACCAGGATAAAGCACTCGATCCTAGCAGACTCAGTCGTGCTCGGCAGAAAC
TGCGTCGTCCCAGCCGGCTCCCTCCTTTCAACCCGAGTCCGCGTCGGTCACGGTGTAGCACTCAACCGGACCGCC
GTGCTTTCGACGCTCTCTCCCTCCGGCGAGCCGGTCATCGGTGACACGGCCCTGCTCGGACCCGAGACCAACGCA
GCCCCCTTCGACCTCCACAGCGGCGACGGCGACGGCGACGACGACGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail