Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6692
Gene name
LocationContig_753:1248..3548
Strand-
Gene length (bp)2300
Transcript length (bp)2247
Coding sequence length (bp)2247
Protein length (aa) 749

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11204 DUF2985 Protein of unknown function (DUF2985) 8.9E-21 395 468

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

Domain # Start End Length
1 405 427 22
2 434 456 22
3 461 480 19
4 634 656 22
5 671 693 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6692
MASTTEPEPDPGGGGRREHKDDDDDHHGPRRMDPTQATNTAPNAAPEIVVEERLSRIPSPISAQEVTHQSPARPA
PAPRQPSIRIRSHTIGSGSGRARVSLGGAEGLDVAAIGILSTRPRSGSQTSVLTAPPDAARGGLRRMPVGQLTQP
SPAHLPRLTEEGVRPSAADLKAVDERETVVARDEEAGAPKKARRVSRFLWPAAGGRKSQAASASPAPDEGGFQPL
RSRQEDEYDEQLVDWLDIIDPEVQTLSTLTNVQNSLFVPDLGNWINRRPTYVLSHHDGLLRRPASVGGPRMTAPM
APAATPTPAPPPPPSTAPGADDDDDKTDSVTTAPPMRRSATITSRLSDSHYAALPHGKTLEGWSAADKSELDDHV
RHMLHSRRARFKRTMKGFGQYVRRPLGFFVTLYATLITLFGLAWVLFLIGWIYVGEKQVYAIHIIDSVLVALFAI
MGDGLAPFRAIDTYHMIFVVHYMRIIKAASRPPRSRLRKRRPWNFGRRGGAESTAAGTSSMAPPPQSSSSSAPVN
VPHPPSTASDDGPPTPPPPPTADDDVDARTNMVVIDLEDGKSDQAGADADRPSSEVELEAQETDGEIADSAAYYP
LTPKQRRSLIHHQQKLSKSHSFYKPQETLTHYSFPLAYLMAIVILLDCHSCLQISLGACTWGIDYHVRPFALTTV
ILCVSISCNLSAGIVIMVGDRRTRKKDVIRLLNRQELTGDAIKTIEHRRQKRDERRTEELLDRIADAASDDKR*
Coding >Ophun1|6692
ATGGCCTCGACGACGGAGCCTGAGCCTGATCCTGGGGGTGGCGGTCGGAGGGAGCATAAGGATGATGACGACGAC
CATCATGGTCCTCGACGGATGGATCCAACGCAGGCCACGAATACAGCCCCGAATGCAGCCCCCGAGATTGTCGTC
GAAGAGCGTCTGAGCCGGATCCCGTCGCCCATCTCGGCGCAGGAAGTGACACACCAGTCACCAGCCCGGCCGGCG
CCGGCCCCTCGCCAGCCCAGCATCCGCATCCGCTCCCATACCATCGGCTCTGGCTCCGGCCGCGCCCGCGTCTCG
CTCGGCGGGGCTGAGGGCCTCGATGTGGCAGCCATTGGCATCTTATCGACTCGGCCTCGCAGTGGTTCGCAGACG
AGCGTCCTGACGGCGCCCCCTGATGCCGCCCGAGGGGGCTTGAGGAGGATGCCGGTTGGGCAGCTCACGCAACCG
TCGCCCGCTCATCTACCGCGCCTGACCGAGGAAGGCGTGCGGCCGTCTGCGGCGGATCTCAAGGCCGTGGATGAA
CGAGAGACGGTGGTGGCTCGCGATGAGGAGGCTGGGGCACCGAAGAAGGCGCGTCGTGTCAGTCGCTTTCTGTGG
CCGGCTGCGGGCGGGAGGAAGAGTCAGGCTGCTTCTGCGTCTCCCGCGCCTGACGAGGGCGGGTTCCAGCCTCTG
CGATCGCGTCAGGAGGATGAATACGATGAGCAGCTGGTTGACTGGCTGGACATTATCGATCCCGAGGTGCAGACG
CTATCCACGCTCACCAACGTTCAAAACTCTCTCTTCGTTCCTGACCTCGGAAACTGGATTAACCGTCGGCCCACG
TACGTGCTCTCTCATCATGATGGCCTGCTCCGGAGGCCCGCATCGGTCGGCGGTCCCCGGATGACGGCGCCGATG
GCCCCGGCCGCCACTCCGACTCCGGCTCCGCCCCCGCCTCCCTCGACGGCCCCGGGCGCCGACGACGACGACGAC
AAGACGGACTCGGTGACGACGGCTCCGCCCATGCGCCGGTCGGCAACCATCACCTCCCGCCTCTCCGACTCGCAC
TACGCCGCGCTCCCTCACGGTAAGACGCTCGAGGGCTGGAGCGCGGCCGACAAGTCGGAGCTCGACGACCACGTG
CGACACATGCTGCATTCGCGGCGCGCTCGCTTCAAGCGCACCATGAAGGGCTTCGGCCAGTACGTGCGCCGCCCC
CTGGGCTTCTTCGTCACCCTCTACGCCACCCTCATCACCCTCTTCGGCCTCGCCTGGGTCCTCTTCCTCATCGGC
TGGATCTACGTCGGCGAGAAGCAGGTGTACGCCATCCACATCATCGACAGCGTCCTCGTCGCCCTCTTCGCCATC
ATGGGCGACGGACTGGCTCCCTTTCGCGCCATCGACACGTACCACATGATCTTTGTCGTCCATTACATGCGCATC
ATCAAGGCCGCCTCGCGTCCGCCCCGGAGTCGGCTACGGAAGCGTCGGCCCTGGAACTTTGGTCGCCGTGGCGGA
GCCGAATCGACAGCGGCCGGCACGTCATCGATGGCTCCGCCTCCGCAGTCTTCCTCCTCGTCGGCTCCCGTCAAC
GTCCCCCATCCCCCGTCGACGGCTTCGGATGATGGCCCTCCCACGCCACCACCGCCGCCAACCGCCGATGACGAC
GTCGATGCCCGCACCAACATGGTCGTCATCGACCTCGAGGACGGCAAGTCGGATCAGGCCGGCGCCGACGCAGAC
CGTCCTTCGTCAGAGGTCGAGCTCGAAGCCCAAGAGACCGACGGCGAAATTGCCGATTCAGCCGCCTACTACCCC
CTCACACCCAAGCAACGACGCAGCCTCATCCACCACCAGCAAAAGCTCAGCAAATCCCACAGCTTCTACAAGCCG
CAGGAGACGCTGACGCACTACTCCTTCCCCCTCGCCTACCTCATGGCCATCGTCATCCTCCTCGACTGCCACTCC
TGCCTGCAAATCTCCCTCGGCGCCTGTACATGGGGAATCGACTACCACGTCCGCCCCTTTGCCCTCACCACCGTC
ATCCTCTGCGTCAGCATCTCGTGCAACCTCTCGGCCGGCATCGTCATCATGGTCGGCGACCGACGCACCCGCAAA
AAGGACGTGATCCGCCTGCTCAACCGCCAGGAACTCACGGGCGATGCCATCAAGACTATTGAGCATCGGCGGCAG
AAGAGGGATGAGCGGAGGACGGAGGAGTTGCTGGATCGGATTGCTGATGCGGCGTCTGATGATAAGCGGTGA
Transcript >Ophun1|6692
ATGGCCTCGACGACGGAGCCTGAGCCTGATCCTGGGGGTGGCGGTCGGAGGGAGCATAAGGATGATGACGACGAC
CATCATGGTCCTCGACGGATGGATCCAACGCAGGCCACGAATACAGCCCCGAATGCAGCCCCCGAGATTGTCGTC
GAAGAGCGTCTGAGCCGGATCCCGTCGCCCATCTCGGCGCAGGAAGTGACACACCAGTCACCAGCCCGGCCGGCG
CCGGCCCCTCGCCAGCCCAGCATCCGCATCCGCTCCCATACCATCGGCTCTGGCTCCGGCCGCGCCCGCGTCTCG
CTCGGCGGGGCTGAGGGCCTCGATGTGGCAGCCATTGGCATCTTATCGACTCGGCCTCGCAGTGGTTCGCAGACG
AGCGTCCTGACGGCGCCCCCTGATGCCGCCCGAGGGGGCTTGAGGAGGATGCCGGTTGGGCAGCTCACGCAACCG
TCGCCCGCTCATCTACCGCGCCTGACCGAGGAAGGCGTGCGGCCGTCTGCGGCGGATCTCAAGGCCGTGGATGAA
CGAGAGACGGTGGTGGCTCGCGATGAGGAGGCTGGGGCACCGAAGAAGGCGCGTCGTGTCAGTCGCTTTCTGTGG
CCGGCTGCGGGCGGGAGGAAGAGTCAGGCTGCTTCTGCGTCTCCCGCGCCTGACGAGGGCGGGTTCCAGCCTCTG
CGATCGCGTCAGGAGGATGAATACGATGAGCAGCTGGTTGACTGGCTGGACATTATCGATCCCGAGGTGCAGACG
CTATCCACGCTCACCAACGTTCAAAACTCTCTCTTCGTTCCTGACCTCGGAAACTGGATTAACCGTCGGCCCACG
TACGTGCTCTCTCATCATGATGGCCTGCTCCGGAGGCCCGCATCGGTCGGCGGTCCCCGGATGACGGCGCCGATG
GCCCCGGCCGCCACTCCGACTCCGGCTCCGCCCCCGCCTCCCTCGACGGCCCCGGGCGCCGACGACGACGACGAC
AAGACGGACTCGGTGACGACGGCTCCGCCCATGCGCCGGTCGGCAACCATCACCTCCCGCCTCTCCGACTCGCAC
TACGCCGCGCTCCCTCACGGTAAGACGCTCGAGGGCTGGAGCGCGGCCGACAAGTCGGAGCTCGACGACCACGTG
CGACACATGCTGCATTCGCGGCGCGCTCGCTTCAAGCGCACCATGAAGGGCTTCGGCCAGTACGTGCGCCGCCCC
CTGGGCTTCTTCGTCACCCTCTACGCCACCCTCATCACCCTCTTCGGCCTCGCCTGGGTCCTCTTCCTCATCGGC
TGGATCTACGTCGGCGAGAAGCAGGTGTACGCCATCCACATCATCGACAGCGTCCTCGTCGCCCTCTTCGCCATC
ATGGGCGACGGACTGGCTCCCTTTCGCGCCATCGACACGTACCACATGATCTTTGTCGTCCATTACATGCGCATC
ATCAAGGCCGCCTCGCGTCCGCCCCGGAGTCGGCTACGGAAGCGTCGGCCCTGGAACTTTGGTCGCCGTGGCGGA
GCCGAATCGACAGCGGCCGGCACGTCATCGATGGCTCCGCCTCCGCAGTCTTCCTCCTCGTCGGCTCCCGTCAAC
GTCCCCCATCCCCCGTCGACGGCTTCGGATGATGGCCCTCCCACGCCACCACCGCCGCCAACCGCCGATGACGAC
GTCGATGCCCGCACCAACATGGTCGTCATCGACCTCGAGGACGGCAAGTCGGATCAGGCCGGCGCCGACGCAGAC
CGTCCTTCGTCAGAGGTCGAGCTCGAAGCCCAAGAGACCGACGGCGAAATTGCCGATTCAGCCGCCTACTACCCC
CTCACACCCAAGCAACGACGCAGCCTCATCCACCACCAGCAAAAGCTCAGCAAATCCCACAGCTTCTACAAGCCG
CAGGAGACGCTGACGCACTACTCCTTCCCCCTCGCCTACCTCATGGCCATCGTCATCCTCCTCGACTGCCACTCC
TGCCTGCAAATCTCCCTCGGCGCCTGTACATGGGGAATCGACTACCACGTCCGCCCCTTTGCCCTCACCACCGTC
ATCCTCTGCGTCAGCATCTCGTGCAACCTCTCGGCCGGCATCGTCATCATGGTCGGCGACCGACGCACCCGCAAA
AAGGACGTGATCCGCCTGCTCAACCGCCAGGAACTCACGGGCGATGCCATCAAGACTATTGAGCATCGGCGGCAG
AAGAGGGATGAGCGGAGGACGGAGGAGTTGCTGGATCGGATTGCTGATGCGGCGTCTGATGATAAGCGGTGA
Gene >Ophun1|6692
ATGGCCTCGACGACGGAGCCTGAGCCTGATCCTGGGGGTGGCGGTCGGAGGGAGCATAAGGATGATGACGACGAC
CATCATGGTCCTCGACGGATGGATCCAACGCAGGCCACGAATACAGCCCCGAATGCAGCCCCCGAGATTGTCGTC
GAAGAGCGTCTGAGCCGGATCCCGTCGCCCATCTCGGCGCAGGAAGTGACACACCAGTCACCAGCCCGGCCGGCG
CCGGCCCCTCGCCAGCCCAGCATCCGCATCCGCTCCCATACCATCGGCTCTGGCTCCGGCCGCGCCCGCGTCTCG
CTCGGCGGGGCTGAGGGCCTCGATGTGGCAGCCATTGGCATCTTATCGACTCGGCCTCGCAGTGGTTCGCAGACG
AGCGTCCTGACGGCGCCCCCTGATGCCGCCCGAGGGGGCTTGAGGAGGATGCCGGTTGGGCAGCTCACGCAACCG
TCGCCCGCTCATCTACCGCGCCTGACCGAGGAAGGCGTGCGGCCGTCTGCGGCGGATCTCAAGGCCGTGGATGAA
CGAGAGACGGTGGTGGCTCGCGATGAGGAGGCTGGGGCACCGAAGAAGGCGCGTCGTGTCAGTCGCTTTCTGTGG
CCGGCTGCGGGCGGGAGGAAGAGTCAGGCTGCTTCTGCGTCTCCCGCGCCTGACGAGGGCGGGTTCCAGCCTCTG
CGATCGCGTCAGGAGGATGAATACGATGAGCAGCTGGTTGACTGGCTGGACATTATCGGTGCGTTTCCTCGCGCC
GTTACATCCATCAATCTTGGCTAACGCGCGTGCTAGATCCCGAGGTGCAGACGCTATCCACGCTCACCAACGTTC
AAAACTCTCTCTTCGTTCCTGACCTCGGAAACTGGATTAACCGTCGGCCCACGTACGTGCTCTCTCATCATGATG
GCCTGCTCCGGAGGCCCGCATCGGTCGGCGGTCCCCGGATGACGGCGCCGATGGCCCCGGCCGCCACTCCGACTC
CGGCTCCGCCCCCGCCTCCCTCGACGGCCCCGGGCGCCGACGACGACGACGACAAGACGGACTCGGTGACGACGG
CTCCGCCCATGCGCCGGTCGGCAACCATCACCTCCCGCCTCTCCGACTCGCACTACGCCGCGCTCCCTCACGGTA
AGACGCTCGAGGGCTGGAGCGCGGCCGACAAGTCGGAGCTCGACGACCACGTGCGACACATGCTGCATTCGCGGC
GCGCTCGCTTCAAGCGCACCATGAAGGGCTTCGGCCAGTACGTGCGCCGCCCCCTGGGCTTCTTCGTCACCCTCT
ACGCCACCCTCATCACCCTCTTCGGCCTCGCCTGGGTCCTCTTCCTCATCGGCTGGATCTACGTCGGCGAGAAGC
AGGTGTACGCCATCCACATCATCGACAGCGTCCTCGTCGCCCTCTTCGCCATCATGGGCGACGGACTGGCTCCCT
TTCGCGCCATCGACACGTACCACATGATCTTTGTCGTCCATTACATGCGCATCATCAAGGCCGCCTCGCGTCCGC
CCCGGAGTCGGCTACGGAAGCGTCGGCCCTGGAACTTTGGTCGCCGTGGCGGAGCCGAATCGACAGCGGCCGGCA
CGTCATCGATGGCTCCGCCTCCGCAGTCTTCCTCCTCGTCGGCTCCCGTCAACGTCCCCCATCCCCCGTCGACGG
CTTCGGATGATGGCCCTCCCACGCCACCACCGCCGCCAACCGCCGATGACGACGTCGATGCCCGCACCAACATGG
TCGTCATCGACCTCGAGGACGGCAAGTCGGATCAGGCCGGCGCCGACGCAGACCGTCCTTCGTCAGAGGTCGAGC
TCGAAGCCCAAGAGACCGACGGCGAAATTGCCGATTCAGCCGCCTACTACCCCCTCACACCCAAGCAACGACGCA
GCCTCATCCACCACCAGCAAAAGCTCAGCAAATCCCACAGCTTCTACAAGCCGCAGGAGACGCTGACGCACTACT
CCTTCCCCCTCGCCTACCTCATGGCCATCGTCATCCTCCTCGACTGCCACTCCTGCCTGCAAATCTCCCTCGGCG
CCTGTACATGGGGAATCGACTACCACGTCCGCCCCTTTGCCCTCACCACCGTCATCCTCTGCGTCAGCATCTCGT
GCAACCTCTCGGCCGGCATCGTCATCATGGTCGGCGACCGACGCACCCGCAAAAAGGACGTGATCCGCCTGCTCA
ACCGCCAGGAACTCACGGGCGATGCCATCAAGACTATTGAGCATCGGCGGCAGAAGAGGGATGAGCGGAGGACGG
AGGAGTTGCTGGATCGGATTGCTGATGCGGCGTCTGATGATAAGCGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail