Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6690
Gene name
LocationContig_752:531..2623
Strand+
Gene length (bp)2092
Transcript length (bp)2007
Coding sequence length (bp)2007
Protein length (aa) 669

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07717 OB_NTP_bind Oligonucleotide/oligosaccharide-binding (OB)-fold 1.2E-16 578 655
PF04408 HA2 Helicase associated domain (HA2) 1.1E-13 420 509
PF00271 Helicase_C Helicase conserved C-terminal domain 6.1E-11 229 358

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 21 658 0.0E+00
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 21 658 0.0E+00
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 14 658 0.0E+00
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 21 665 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 21 667 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9H5Z1|DHX35_HUMAN Probable ATP-dependent RNA helicase DHX35 OS=Homo sapiens GN=DHX35 PE=1 SV=2 21 658 0.0E+00
sp|Q5RBD4|DHX35_PONAB Probable ATP-dependent RNA helicase DHX35 OS=Pongo abelii GN=DHX35 PE=2 SV=1 21 658 0.0E+00
sp|F4JRJ6|DEAH9_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH9 OS=Arabidopsis thaliana GN=At4g18465 PE=3 SV=1 14 658 0.0E+00
sp|Q9BKQ8|DHX35_CAEEL Probable ATP-dependent RNA helicase DHX35 homolog OS=Caenorhabditis elegans GN=Y67D2.6 PE=3 SV=1 21 665 0.0E+00
sp|Q8VY00|ESP3_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH1 OS=Arabidopsis thaliana GN=ESP3 PE=1 SV=1 21 667 0.0E+00
sp|Q9LZQ9|DEAH2_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH2 OS=Arabidopsis thaliana GN=At3g62310 PE=2 SV=1 21 660 0.0E+00
sp|F4IJV4|DEAH6_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH6 OS=Arabidopsis thaliana GN=MEE29 PE=2 SV=1 14 659 0.0E+00
sp|O45244|DHX16_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-4 OS=Caenorhabditis elegans GN=mog-4 PE=1 SV=2 21 658 0.0E+00
sp|Q14562|DHX8_HUMAN ATP-dependent RNA helicase DHX8 OS=Homo sapiens GN=DHX8 PE=1 SV=1 21 660 0.0E+00
sp|A2A4P0|DHX8_MOUSE ATP-dependent RNA helicase DHX8 OS=Mus musculus GN=Dhx8 PE=2 SV=1 21 660 1.0E-180
sp|F4JMJ3|DEAH8_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH8 OS=Arabidopsis thaliana GN=At4g16680 PE=2 SV=2 20 659 3.0E-180
sp|O22899|PRP43_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH3 OS=Arabidopsis thaliana GN=At2g47250 PE=2 SV=1 21 660 4.0E-180
sp|Q38953|DEAH5_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH5 OS=Arabidopsis thaliana GN=At3g26560 PE=1 SV=2 21 660 7.0E-180
sp|Q54F05|DHX8_DICDI ATP-dependent RNA helicase dhx8 OS=Dictyostelium discoideum GN=dhx8 PE=3 SV=1 21 660 2.0E-177
sp|Q54NJ4|DHX15_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase dhx15 OS=Dictyostelium discoideum GN=dhx15 PE=3 SV=1 21 658 2.0E-177
sp|F4IE66|PRP22_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH10 OS=Arabidopsis thaliana GN=RID1 PE=1 SV=1 21 658 8.0E-177
sp|O35286|DHX15_MOUSE Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Mus musculus GN=Dhx15 PE=1 SV=2 21 660 1.0E-176
sp|Q5RAZ4|DHX15_PONAB Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Pongo abelii GN=DHX15 PE=2 SV=2 21 660 3.0E-176
sp|O43143|DHX15_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase DHX15 OS=Homo sapiens GN=DHX15 PE=1 SV=2 21 660 4.0E-176
sp|O60231|DHX16_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Homo sapiens GN=DHX16 PE=1 SV=2 21 667 5.0E-176
sp|Q7YR39|DHX16_PANTR Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Pan troglodytes GN=DHX16 PE=3 SV=1 21 667 6.0E-176
sp|Q767K6|DHX16_PIG Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Sus scrofa GN=DHX16 PE=3 SV=1 21 667 2.0E-175
sp|O42643|PRP22_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp22 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp22 PE=1 SV=1 21 662 2.0E-175
sp|O42945|DHX15_SCHPO Probable pre-mRNA-splicing factor ATP-dependent RNA helicase prp43 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp43 PE=3 SV=1 21 659 1.0E-174
sp|Q54MH3|DHX16_DICDI Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX16 OS=Dictyostelium discoideum GN=dhx16 PE=3 SV=1 21 658 4.0E-174
sp|Q9HE06|YK99_SCHPO Putative pre-mRNA-splicing factor ATP-dependent RNA helicase C20H4.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.09 PE=3 SV=1 14 652 2.0E-173
sp|Q09530|MOG5_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-5 OS=Caenorhabditis elegans GN=mog-5 PE=1 SV=1 21 659 1.0E-171
sp|P24384|PRP22_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP22 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP22 PE=1 SV=1 21 658 2.0E-171
sp|P53131|PRP43_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP43 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP43 PE=1 SV=1 21 660 3.0E-167
sp|Q20875|DHX15_CAEEL Pre-mRNA-splicing factor ATP-dependent RNA helicase ddx-15 OS=Caenorhabditis elegans GN=ddx-15 PE=3 SV=1 13 659 2.0E-166
sp|Q10752|CDC28_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein cdc28 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cdc28 PE=3 SV=2 21 658 4.0E-165
sp|Q9H6R0|DHX33_HUMAN Putative ATP-dependent RNA helicase DHX33 OS=Homo sapiens GN=DHX33 PE=1 SV=2 21 658 2.0E-161
sp|P34498|MOG1_CAEEL Probable pre-mRNA-splicing factor ATP-dependent RNA helicase mog-1 OS=Caenorhabditis elegans GN=mog-1 PE=1 SV=2 1 663 4.0E-161
sp|Q80VY9|DHX33_MOUSE Putative ATP-dependent RNA helicase DHX33 OS=Mus musculus GN=Dhx33 PE=1 SV=1 21 658 2.0E-159
sp|Q03319|PRH1_SCHPO Probable ATP-dependent RNA helicase prh1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prh1 PE=3 SV=2 21 656 9.0E-156
sp|Q92620|PRP16_HUMAN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Homo sapiens GN=DHX38 PE=1 SV=2 21 662 7.0E-152
sp|Q17R09|PRP16_BOVIN Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Bos taurus GN=DHX38 PE=2 SV=1 21 662 9.0E-152
sp|F4K2E9|PRP16_ARATH Pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH7 OS=Arabidopsis thaliana GN=CUV PE=1 SV=1 21 659 3.0E-149
sp|Q9P774|PRP16_SCHPO Pre-mRNA-splicing factor ATP-dependent RNA helicase prp16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prp16 PE=3 SV=2 20 659 2.0E-148
sp|P20095|PRP2_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase-like protein PRP2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP2 PE=1 SV=1 11 658 2.0E-143
sp|Q6PE54|DHX40_MOUSE Probable ATP-dependent RNA helicase DHX40 OS=Mus musculus GN=Dhx40 PE=1 SV=1 21 660 9.0E-136
sp|Q5XI69|DHX40_RAT Probable ATP-dependent RNA helicase DHX40 OS=Rattus norvegicus GN=Dhx40 PE=2 SV=1 21 660 7.0E-135
sp|P15938|PRP16_YEAST Pre-mRNA-splicing factor ATP-dependent RNA helicase PRP16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PRP16 PE=1 SV=2 21 664 7.0E-135
sp|Q8IX18|DHX40_HUMAN Probable ATP-dependent RNA helicase DHX40 OS=Homo sapiens GN=DHX40 PE=1 SV=2 21 660 2.0E-134
sp|Q5R864|DHX40_PONAB Probable ATP-dependent RNA helicase DHX40 OS=Pongo abelii GN=DHX40 PE=2 SV=1 21 660 8.0E-134
sp|P36009|DHR2_YEAST Probable ATP-dependent RNA helicase DHR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DHR2 PE=1 SV=1 14 651 1.0E-131
sp|Q93Y16|DEAH4_ARATH Probable pre-mRNA-splicing factor ATP-dependent RNA helicase DEAH4 OS=Arabidopsis thaliana GN=At1g27900 PE=1 SV=1 21 649 8.0E-131
sp|O17438|DHX15_STRPU Putative pre-mRNA-splicing factor ATP-dependent RNA helicase PRP1 (Fragment) OS=Strongylocentrotus purpuratus GN=PRP1 PE=2 SV=1 107 557 3.0E-129
sp|P45018|HRPA_HAEIN ATP-dependent RNA helicase HrpA homolog OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=hrpA PE=3 SV=2 21 649 6.0E-101
sp|P43329|HRPA_ECOLI ATP-dependent RNA helicase HrpA OS=Escherichia coli (strain K12) GN=hrpA PE=3 SV=3 12 649 2.0E-98
sp|Q14147|DHX34_HUMAN Probable ATP-dependent RNA helicase DHX34 OS=Homo sapiens GN=DHX34 PE=1 SV=2 3 582 8.0E-98
sp|Q9HDY4|YK16_SCHPO Putative ATP-dependent RNA helicase PB1A10.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A10.06c PE=3 SV=1 12 560 2.0E-96
sp|Q9DBV3|DHX34_MOUSE Probable ATP-dependent RNA helicase DHX34 OS=Mus musculus GN=Dhx34 PE=1 SV=2 3 597 7.0E-95
sp|Q04217|DHR1_YEAST Probable ATP-dependent RNA helicase DHR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ECM16 PE=1 SV=1 21 591 7.0E-90
sp|F4KGU4|DEAHC_ARATH ATP-dependent RNA helicase DEAH12, chloroplastic OS=Arabidopsis thaliana GN=At5g10370 PE=3 SV=1 21 656 4.0E-86
sp|P0CE10|DEAHB_ARATH ATP-dependent RNA helicase DEAH11, chloroplastic OS=Arabidopsis thaliana GN=At4g01020 PE=3 SV=1 21 656 2.0E-82
sp|Q5XH12|DHX32_XENLA Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Xenopus laevis GN=dhx32 PE=2 SV=1 14 657 1.0E-81
sp|Q8BZS9|DHX32_MOUSE Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Mus musculus GN=Dhx32 PE=1 SV=2 21 657 5.0E-80
sp|F4HYJ7|DEXH3_ARATH DExH-box ATP-dependent RNA helicase DExH3 OS=Arabidopsis thaliana GN=At1g48650 PE=2 SV=1 21 653 5.0E-77
sp|Q9C6G0|DEXH4_ARATH DExH-box ATP-dependent RNA helicase DExH4, chloroplastic OS=Arabidopsis thaliana GN=At1g58050 PE=3 SV=1 16 644 8.0E-74
sp|Q7L7V1|DHX32_HUMAN Putative pre-mRNA-splicing factor ATP-dependent RNA helicase DHX32 OS=Homo sapiens GN=DHX32 PE=1 SV=1 21 657 3.0E-73
sp|Q8VHK9|DHX36_MOUSE ATP-dependent RNA helicase DHX36 OS=Mus musculus GN=Dhx36 PE=1 SV=2 21 650 5.0E-73
sp|Q9H2U1|DHX36_HUMAN ATP-dependent RNA helicase DHX36 OS=Homo sapiens GN=DHX36 PE=1 SV=2 21 650 5.0E-72
sp|Q7L2E3|DHX30_HUMAN Putative ATP-dependent RNA helicase DHX30 OS=Homo sapiens GN=DHX30 PE=1 SV=1 21 645 4.0E-71
sp|Q5BJS0|DHX30_RAT Putative ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus GN=Dhx30 PE=1 SV=1 21 645 1.0E-70
sp|Q99PU8|DHX30_MOUSE Putative ATP-dependent RNA helicase DHX30 OS=Mus musculus GN=Dhx30 PE=1 SV=1 21 645 2.0E-70
sp|Q5ZI74|DHX30_CHICK Putative ATP-dependent RNA helicase DHX30 OS=Gallus gallus GN=DHX30 PE=2 SV=1 18 645 3.0E-70
sp|Q5R607|DHX30_PONAB Putative ATP-dependent RNA helicase DHX30 OS=Pongo abelii GN=DHX30 PE=2 SV=1 21 645 4.0E-70
sp|Q2NKY8|DHX30_BOVIN Putative ATP-dependent RNA helicase DHX30 OS=Bos taurus GN=DHX30 PE=2 SV=1 21 645 7.0E-70
sp|Q924H9|DQX1_MOUSE ATP-dependent RNA helicase DQX1 OS=Mus musculus GN=Dqx1 PE=2 SV=1 21 657 3.0E-66
sp|Q28141|DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus GN=DHX9 PE=2 SV=1 20 556 4.0E-65
sp|Q68FK8|DHX9_XENLA ATP-dependent RNA helicase A-like protein OS=Xenopus laevis GN=dhx9 PE=2 SV=1 21 591 2.0E-64
sp|Q3ZBE0|DQX1_BOVIN ATP-dependent RNA helicase DQX1 OS=Bos taurus GN=DQX1 PE=2 SV=1 21 657 2.0E-63
sp|Q06698|YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR419W PE=1 SV=1 21 607 9.0E-62
sp|B8A4F4|TDRD9_DANRE Putative ATP-dependent RNA helicase TDRD9 OS=Danio rerio GN=tdrd9 PE=2 SV=1 20 564 2.0E-61
sp|P24785|MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster GN=mle PE=1 SV=2 21 539 1.0E-60
sp|Q8TE96|DQX1_HUMAN ATP-dependent RNA helicase DQX1 OS=Homo sapiens GN=DQX1 PE=2 SV=2 21 657 1.0E-59
sp|O60114|YG65_SCHPO Uncharacterized helicase C15C4.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC15C4.05 PE=3 SV=1 21 548 6.0E-58
sp|O94536|UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ucp12 PE=3 SV=1 21 645 1.0E-56
sp|O70133|DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus GN=Dhx9 PE=1 SV=2 20 560 3.0E-56
sp|Q8NDG6|TDRD9_HUMAN Putative ATP-dependent RNA helicase TDRD9 OS=Homo sapiens GN=TDRD9 PE=2 SV=3 21 562 2.0E-55
sp|Q14BI7|TDRD9_MOUSE Putative ATP-dependent RNA helicase TDRD9 OS=Mus musculus GN=Tdrd9 PE=1 SV=3 21 559 4.0E-54
sp|Q3MHU3|TDRD9_RAT Putative ATP-dependent RNA helicase TDRD9 OS=Rattus norvegicus GN=Tdrd9 PE=2 SV=3 21 562 4.0E-54
sp|P37024|HRPB_ECOLI ATP-dependent RNA helicase HrpB OS=Escherichia coli (strain K12) GN=hrpB PE=3 SV=3 19 460 2.0E-53
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 219 653 1.0E-52
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 271 661 9.0E-52
sp|Q7QCW2|SPNE_ANOGA Probable ATP-dependent RNA helicase spindle-E OS=Anopheles gambiae GN=spn-E PE=3 SV=5 21 589 1.0E-50
sp|B4PRJ9|SPNE_DROYA Probable ATP-dependent RNA helicase spindle-E OS=Drosophila yakuba GN=spn-E PE=3 SV=1 21 500 1.0E-49
sp|B3P3W1|SPNE_DROER Probable ATP-dependent RNA helicase spindle-E OS=Drosophila erecta GN=spn-E PE=3 SV=1 21 480 2.0E-49
sp|B4JT42|SPNE_DROGR Probable ATP-dependent RNA helicase spindle-E OS=Drosophila grimshawi GN=spn-E PE=3 SV=1 21 492 3.0E-49
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 228 642 4.0E-48
sp|B4LX81|SPNE_DROVI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila virilis GN=spn-E PE=3 SV=1 21 474 7.0E-48
sp|B3M383|SPNE_DROAN Probable ATP-dependent RNA helicase spindle-E OS=Drosophila ananassae GN=spn-E PE=3 SV=1 21 480 8.0E-48
sp|B4HLH4|SPNE_DROSE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila sechellia GN=spn-E PE=3 SV=1 21 496 9.0E-48
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 218 642 1.0E-47
sp|Q296Q5|SPNE_DROPS Probable ATP-dependent RNA helicase spindle-E OS=Drosophila pseudoobscura pseudoobscura GN=spn-E PE=3 SV=2 21 480 2.0E-47
sp|Q16JS8|SPNE_AEDAE Probable ATP-dependent RNA helicase spindle-E OS=Aedes aegypti GN=spn-E PE=3 SV=1 21 544 2.0E-47
sp|B0XDC4|SPNE_CULQU Probable ATP-dependent RNA helicase spindle-E OS=Culex quinquefasciatus GN=spn-E PE=3 SV=1 21 523 5.0E-47
sp|Q9VF26|SPNE_DROME Probable ATP-dependent RNA helicase spindle-E OS=Drosophila melanogaster GN=spn-E PE=2 SV=1 21 496 9.0E-47
sp|B4NBB0|SPNE_DROWI Probable ATP-dependent RNA helicase spindle-E OS=Drosophila willistoni GN=spn-E PE=3 SV=1 21 480 3.0E-46
sp|B4GEU5|SPNE_DROPE Probable ATP-dependent RNA helicase spindle-E OS=Drosophila persimilis GN=spn-E PE=3 SV=1 21 480 5.0E-46
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 237 644 3.0E-45
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 237 644 3.0E-45
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 21 257 5.0E-45
sp|B4K5R2|SPNE_DROMO Probable ATP-dependent RNA helicase spindle-E OS=Drosophila mojavensis GN=spn-E PE=3 SV=1 21 474 1.0E-44
sp|O46072|KZ_DROME Probable ATP-dependent RNA helicase kurz OS=Drosophila melanogaster GN=kz PE=1 SV=1 257 654 2.0E-44
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 238 616 6.0E-44
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 230 642 3.0E-43
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 238 616 6.0E-43
sp|Q5UQ96|YL540_MIMIV Putative ATP-dependent RNA helicase L540 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L540 PE=1 SV=1 19 525 2.0E-42
sp|Q8IY37|DHX37_HUMAN Probable ATP-dependent RNA helicase DHX37 OS=Homo sapiens GN=DHX37 PE=1 SV=1 8 250 3.0E-42
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 14 263 3.0E-42
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 9 263 4.0E-42
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 229 644 6.0E-42
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 216 557 2.0E-41
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 238 644 9.0E-41
sp|Q1EHT7|C3H4_ORYSJ Zinc finger CCCH domain-containing protein 4 OS=Oryza sativa subsp. japonica GN=Os01g0256800 PE=2 SV=1 39 441 2.0E-40
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 225 644 8.0E-40
sp|Q7Z478|DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens GN=DHX29 PE=1 SV=2 14 219 3.0E-38
sp|Q9C813|DEAHD_ARATH ATP-dependent RNA helicase DEAH13 OS=Arabidopsis thaliana GN=FAS4 PE=2 SV=1 253 653 6.0E-37
sp|O22243|C3H31_ARATH DExH-box ATP-dependent RNA helicase DExH8 OS=Arabidopsis thaliana GN=At2g47680 PE=2 SV=2 21 430 6.0E-37
sp|Q6PGC1|DHX29_MOUSE ATP-dependent RNA helicase Dhx29 OS=Mus musculus GN=Dhx29 PE=1 SV=1 14 222 1.0E-36
sp|P34305|RHA2_CAEEL Putative ATP-dependent RNA helicase rha-2 OS=Caenorhabditis elegans GN=rha-2 PE=3 SV=2 274 656 7.0E-36
sp|Q5R874|DHX9_PONAB ATP-dependent RNA helicase A OS=Pongo abelii GN=DHX9 PE=2 SV=1 225 560 1.0E-35
sp|Q08211|DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens GN=DHX9 PE=1 SV=4 225 560 1.0E-35
sp|Q6P158|DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens GN=DHX57 PE=1 SV=2 21 214 2.0E-34
sp|A3KMI0|DHX29_XENLA ATP-dependent RNA helicase DHX29 OS=Xenopus laevis GN=dhx29 PE=2 SV=1 21 222 5.0E-34
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 238 644 3.0E-32
sp|Q6P5D3|DHX57_MOUSE Putative ATP-dependent RNA helicase DHX57 OS=Mus musculus GN=Dhx57 PE=1 SV=2 13 214 4.0E-32
sp|Q22307|DHX9_CAEEL Probable ATP-dependent RNA helicase A OS=Caenorhabditis elegans GN=rha-1 PE=2 SV=3 21 517 2.0E-31
sp|F4ILR7|DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana GN=At2g35920 PE=2 SV=1 21 218 9.0E-31
sp|F4IM84|DEXH5_ARATH DExH-box ATP-dependent RNA helicase DExH5, mitochondrial OS=Arabidopsis thaliana GN=At2g01130 PE=3 SV=1 21 218 1.0E-30
sp|F4IDQ6|NIH_ARATH DExH-box ATP-dependent RNA helicase DExH2 OS=Arabidopsis thaliana GN=NIH PE=1 SV=1 19 213 5.0E-28
sp|B2RR83|YTDC2_MOUSE Probable ATP-dependent RNA helicase YTHDC2 OS=Mus musculus GN=Ythdc2 PE=1 SV=1 21 214 7.0E-28
sp|Q9H6S0|YTDC2_HUMAN Probable ATP-dependent RNA helicase YTHDC2 OS=Homo sapiens GN=YTHDC2 PE=1 SV=2 21 214 8.0E-28
sp|F4I9Q5|DEXH7_ARATH DExH-box ATP-dependent RNA helicase DExH7, chloroplastic OS=Arabidopsis thaliana GN=At1g58060 PE=2 SV=1 16 214 2.0E-26
sp|P0C9A4|H962L_ASFK5 Putative RNA Helicase B962L OS=African swine fever virus (isolate Pig/Kenya/KEN-50/1950) GN=Ken-084 PE=3 SV=1 39 422 5.0E-26
sp|P0C9A2|H962L_ASFP4 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/South Africa/Pretoriuskop Pr4/1996) GN=Pret-084 PE=3 SV=1 39 448 8.0E-26
sp|Q89443|H962L_ASFB7 Putative RNA helicase B962L OS=African swine fever virus (strain Badajoz 1971 Vero-adapted) GN=Ba71V-072 PE=3 SV=1 39 448 9.0E-26
sp|P0C9A3|H962L_ASFWA Putative RNA Helicase B962L OS=African swine fever virus (isolate Warthog/Namibia/Wart80/1980) GN=War-082 PE=3 SV=1 39 448 9.0E-26
sp|F4INY4|HVT1_ARATH DExH-box ATP-dependent RNA helicase DExH6 OS=Arabidopsis thaliana GN=HVT1 PE=2 SV=1 19 214 1.0E-25
sp|Q8V9U2|H962L_ASFM2 Putative RNA Helicase B962L OS=African swine fever virus (isolate Tick/Malawi/Lil 20-1/1983) GN=Mal-080 PE=3 SV=1 39 422 4.0E-25
sp|P0C7L7|YUM14_USTMA Putative DEAH-box ATP-dependent helicase UM11114 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=UMAG_11114 PE=3 SV=1 21 214 4.0E-20
sp|Q5UR20|YR366_MIMIV Putative ATP-dependent RNA helicase R366 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R366 PE=3 SV=1 39 368 6.0E-20
sp|Q5R746|YTDC2_PONAB YTH domain-containing protein 2 OS=Pongo abelii GN=YTHDC2 PE=2 SV=1 380 616 6.0E-10
sp|Q01499|POLG_BVDVS Genome polyprotein OS=Bovine viral diarrhea virus (strain SD-1) PE=1 SV=1 46 365 1.0E-08
sp|P19711|POLG_BVDVN Genome polyprotein OS=Bovine viral diarrhea virus (isolate NADL) PE=1 SV=2 46 365 1.0E-08
sp|Q9Q927|NPH2_RFVKA RNA helicase NPH-II OS=Rabbit fibroma virus (strain Kasza) GN=NPH2 PE=2 SV=1 37 367 1.0E-08
sp|P19712|POLG_CSFVA Genome polyprotein OS=Classical swine fever virus (strain Alfort) PE=1 SV=2 46 365 4.0E-08
sp|P21530|POLG_CSFVB Genome polyprotein OS=Classical swine fever virus (strain Brescia) PE=2 SV=1 46 365 6.0E-08
sp|Q96662|POLG_BVDVC Genome polyprotein OS=Bovine viral diarrhea virus (strain CP7) PE=1 SV=1 46 365 8.0E-08
sp|Q01206|POL1_BAYMJ Genome polyprotein 1 OS=Barley yellow mosaic virus (strain Japanese II-1) PE=3 SV=1 40 361 3.0E-07
sp|Q9W1I2|BGCN_DROME Benign gonial cell neoplasm protein OS=Drosophila melanogaster GN=bgcn PE=1 SV=2 208 477 9.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004386 helicase activity Yes
GO:0140657 ATP-dependent activity No
GO:0003674 molecular_function No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup12
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7861
Ophiocordyceps australis 1348a (Ghana) OphauG2|6896
Ophiocordyceps australis 1348a (Ghana) OphauG2|6506
Ophiocordyceps australis 1348a (Ghana) OphauG2|3168
Ophiocordyceps australis 1348a (Ghana) OphauG2|20
Ophiocordyceps australis map64 (Brazil) OphauB2|5123
Ophiocordyceps australis map64 (Brazil) OphauB2|2680
Ophiocordyceps australis map64 (Brazil) OphauB2|2813
Ophiocordyceps australis map64 (Brazil) OphauB2|2015
Ophiocordyceps australis map64 (Brazil) OphauB2|2149
Ophiocordyceps camponoti-floridani Ophcf2|01559
Ophiocordyceps camponoti-floridani Ophcf2|06888
Ophiocordyceps camponoti-floridani Ophcf2|06302
Ophiocordyceps camponoti-floridani Ophcf2|00261
Ophiocordyceps camponoti-floridani Ophcf2|05778
Ophiocordyceps camponoti-rufipedis Ophun1|1146
Ophiocordyceps camponoti-rufipedis Ophun1|308
Ophiocordyceps camponoti-rufipedis Ophun1|5443
Ophiocordyceps camponoti-rufipedis Ophun1|6690 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|6277
Ophiocordyceps kimflemingae Ophio5|3066
Ophiocordyceps kimflemingae Ophio5|4511
Ophiocordyceps kimflemingae Ophio5|5562
Ophiocordyceps kimflemingae Ophio5|6072
Ophiocordyceps kimflemingae Ophio5|7318
Ophiocordyceps subramaniannii Hirsu2|9346
Ophiocordyceps subramaniannii Hirsu2|8271
Ophiocordyceps subramaniannii Hirsu2|11264
Ophiocordyceps subramaniannii Hirsu2|10215
Ophiocordyceps subramaniannii Hirsu2|10021

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6690
MADFDLDASFIPALHKPSSLLPIAKHRESLLYVIETHPVTIVLGQTGSGKTTQIPQFLWHAGCRRQPRRVAATTV
ALRVADEVGCEIGKEVGYSIRFEDVTSSATRIKFLTDGLLVREALVDPLLSRYSVIMVDEAHERSASTDILLGLL
SKIIKKRSDLRVVVSSATLQAQEFFDYFTRGEQKPDGDGEARDESAAIVSLEGRTYPIDVLYLQSPAEDYVETAI
DTVLRIHTDEGPGDILVFLTGREQIDYAVQAISDKAGEADSRYATLQPLALYAGLSTEQQMYVFDKPPEGTRKVI
FSTNIAEASVTIDGIVFVVDCGFVKLRAYNAETCIESLTTTAVSKASASQRAGRAGRTKPGKCFRLYTEEAYEAL
QDANVPELQRSNLAPVVLQLKALGIDNVVRFEFLSRPAAGLMAKALELLYALGALDGYAKLTRPLGLRMAELAVP
PMMAKTLLMAPSMGCLGEILSIAAMASLGGSVWFYHDGEQKRMESSRRKFAAEEGDQLTLLNVYAAFAAKGKQQA
RFCHENHINYKAMTRAVSIRAQLRRYLERFGVAVDDKTEGVKGDDGRNKSEQIRRCLTAGFFAHVARMQPDGTFR
NVGGGTVLHAHPSSLLFSRKADWVIFHEVMETGDKTYIRDVTKIEKGWLLEYAPEYYQLSRARGPAAG*
Coding >Ophun1|6690
ATGGCCGACTTTGACCTCGACGCCTCGTTCATTCCAGCCCTGCACAAGCCCTCATCTCTGCTGCCGATAGCGAAA
CATCGCGAGAGCCTCCTCTACGTCATCGAGACGCACCCCGTGACTATCGTCCTCGGCCAGACCGGCTCGGGCAAG
ACGACACAGATACCGCAGTTTCTCTGGCACGCAGGCTGCCGACGACAGCCTCGACGCGTTGCGGCTACGACGGTG
GCGCTTCGCGTCGCCGACGAGGTAGGATGCGAGATCGGGAAAGAGGTCGGCTATTCGATACGCTTCGAGGACGTC
ACGTCGTCGGCAACGCGCATCAAGTTCCTCACCGATGGGCTCCTCGTTCGGGAAGCCCTCGTCGACCCTCTTCTG
AGCAGGTACTCGGTAATCATGGTCGATGAGGCTCACGAGAGGTCGGCGAGCACCGACATCCTTTTGGGACTTCTC
AGCAAGATCATCAAGAAGCGATCCGATCTCCGGGTCGTCGTCAGCAGCGCCACACTGCAGGCTCAAGAATTCTTC
GACTACTTTACCCGTGGGGAACAGAAGCCGGATGGAGATGGTGAGGCGCGAGACGAGTCAGCCGCCATTGTAAGC
CTCGAGGGGCGGACGTATCCGATCGATGTCCTATATTTGCAGTCACCTGCTGAGGACTACGTTGAGACGGCCATC
GATACCGTTCTCCGCATTCACACCGACGAGGGCCCAGGCGACATATTGGTCTTTCTGACGGGCCGCGAGCAGATT
GATTATGCCGTCCAAGCCATCTCGGACAAGGCCGGCGAAGCAGACAGTCGATACGCGACGCTACAGCCGCTGGCG
CTTTACGCCGGACTATCGACGGAGCAGCAGATGTACGTCTTTGACAAGCCCCCAGAGGGTACACGCAAAGTCATC
TTCTCGACCAACATCGCCGAGGCGTCCGTCACCATCGACGGCATCGTCTTCGTCGTCGACTGCGGCTTCGTGAAG
CTGCGAGCCTACAACGCGGAGACGTGTATAGAGTCGCTCACGACGACTGCCGTGTCCAAGGCCTCGGCGTCGCAG
CGAGCTGGTCGCGCCGGTCGAACCAAGCCTGGAAAGTGTTTTCGGCTCTACACCGAAGAGGCCTACGAGGCACTG
CAAGACGCCAACGTACCCGAGCTGCAGAGATCGAACCTCGCGCCGGTGGTGCTGCAGCTCAAAGCCCTGGGCATC
GACAACGTCGTCCGATTCGAGTTCCTATCGCGGCCGGCGGCGGGACTCATGGCCAAGGCGCTCGAGCTGCTCTAC
GCGCTGGGCGCTCTGGACGGGTACGCAAAGCTCACGCGGCCCCTGGGACTGCGCATGGCAGAACTGGCGGTGCCG
CCCATGATGGCCAAGACGCTGCTGATGGCGCCGTCTATGGGCTGCCTCGGCGAGATACTCTCCATCGCGGCCATG
GCCAGCCTCGGCGGCAGCGTGTGGTTCTACCACGACGGAGAGCAGAAGCGAATGGAGAGCTCAAGGCGCAAGTTT
GCCGCCGAAGAAGGCGACCAGCTGACGCTCCTCAACGTCTACGCTGCCTTTGCGGCCAAGGGCAAGCAGCAGGCA
CGCTTCTGCCACGAGAACCACATCAACTACAAGGCCATGACTCGCGCCGTCAGCATCCGCGCGCAACTGAGGCGC
TACCTCGAGCGATTCGGCGTCGCCGTCGACGACAAGACAGAAGGAGTCAAGGGAGACGACGGACGCAACAAGTCG
GAGCAGATACGGCGGTGCCTGACGGCCGGATTCTTTGCCCACGTGGCGCGGATGCAGCCCGACGGCACGTTCCGC
AACGTCGGCGGCGGGACGGTGCTTCATGCGCATCCGAGCTCGCTCCTGTTCAGCCGCAAGGCTGACTGGGTCATC
TTCCACGAGGTTATGGAGACGGGCGACAAGACGTACATCCGGGATGTGACCAAGATCGAAAAGGGATGGCTGCTC
GAGTACGCGCCCGAGTACTACCAGCTGAGCCGCGCCCGAGGCCCAGCAGCTGGATAG
Transcript >Ophun1|6690
ATGGCCGACTTTGACCTCGACGCCTCGTTCATTCCAGCCCTGCACAAGCCCTCATCTCTGCTGCCGATAGCGAAA
CATCGCGAGAGCCTCCTCTACGTCATCGAGACGCACCCCGTGACTATCGTCCTCGGCCAGACCGGCTCGGGCAAG
ACGACACAGATACCGCAGTTTCTCTGGCACGCAGGCTGCCGACGACAGCCTCGACGCGTTGCGGCTACGACGGTG
GCGCTTCGCGTCGCCGACGAGGTAGGATGCGAGATCGGGAAAGAGGTCGGCTATTCGATACGCTTCGAGGACGTC
ACGTCGTCGGCAACGCGCATCAAGTTCCTCACCGATGGGCTCCTCGTTCGGGAAGCCCTCGTCGACCCTCTTCTG
AGCAGGTACTCGGTAATCATGGTCGATGAGGCTCACGAGAGGTCGGCGAGCACCGACATCCTTTTGGGACTTCTC
AGCAAGATCATCAAGAAGCGATCCGATCTCCGGGTCGTCGTCAGCAGCGCCACACTGCAGGCTCAAGAATTCTTC
GACTACTTTACCCGTGGGGAACAGAAGCCGGATGGAGATGGTGAGGCGCGAGACGAGTCAGCCGCCATTGTAAGC
CTCGAGGGGCGGACGTATCCGATCGATGTCCTATATTTGCAGTCACCTGCTGAGGACTACGTTGAGACGGCCATC
GATACCGTTCTCCGCATTCACACCGACGAGGGCCCAGGCGACATATTGGTCTTTCTGACGGGCCGCGAGCAGATT
GATTATGCCGTCCAAGCCATCTCGGACAAGGCCGGCGAAGCAGACAGTCGATACGCGACGCTACAGCCGCTGGCG
CTTTACGCCGGACTATCGACGGAGCAGCAGATGTACGTCTTTGACAAGCCCCCAGAGGGTACACGCAAAGTCATC
TTCTCGACCAACATCGCCGAGGCGTCCGTCACCATCGACGGCATCGTCTTCGTCGTCGACTGCGGCTTCGTGAAG
CTGCGAGCCTACAACGCGGAGACGTGTATAGAGTCGCTCACGACGACTGCCGTGTCCAAGGCCTCGGCGTCGCAG
CGAGCTGGTCGCGCCGGTCGAACCAAGCCTGGAAAGTGTTTTCGGCTCTACACCGAAGAGGCCTACGAGGCACTG
CAAGACGCCAACGTACCCGAGCTGCAGAGATCGAACCTCGCGCCGGTGGTGCTGCAGCTCAAAGCCCTGGGCATC
GACAACGTCGTCCGATTCGAGTTCCTATCGCGGCCGGCGGCGGGACTCATGGCCAAGGCGCTCGAGCTGCTCTAC
GCGCTGGGCGCTCTGGACGGGTACGCAAAGCTCACGCGGCCCCTGGGACTGCGCATGGCAGAACTGGCGGTGCCG
CCCATGATGGCCAAGACGCTGCTGATGGCGCCGTCTATGGGCTGCCTCGGCGAGATACTCTCCATCGCGGCCATG
GCCAGCCTCGGCGGCAGCGTGTGGTTCTACCACGACGGAGAGCAGAAGCGAATGGAGAGCTCAAGGCGCAAGTTT
GCCGCCGAAGAAGGCGACCAGCTGACGCTCCTCAACGTCTACGCTGCCTTTGCGGCCAAGGGCAAGCAGCAGGCA
CGCTTCTGCCACGAGAACCACATCAACTACAAGGCCATGACTCGCGCCGTCAGCATCCGCGCGCAACTGAGGCGC
TACCTCGAGCGATTCGGCGTCGCCGTCGACGACAAGACAGAAGGAGTCAAGGGAGACGACGGACGCAACAAGTCG
GAGCAGATACGGCGGTGCCTGACGGCCGGATTCTTTGCCCACGTGGCGCGGATGCAGCCCGACGGCACGTTCCGC
AACGTCGGCGGCGGGACGGTGCTTCATGCGCATCCGAGCTCGCTCCTGTTCAGCCGCAAGGCTGACTGGGTCATC
TTCCACGAGGTTATGGAGACGGGCGACAAGACGTACATCCGGGATGTGACCAAGATCGAAAAGGGATGGCTGCTC
GAGTACGCGCCCGAGTACTACCAGCTGAGCCGCGCCCGAGGCCCAGCAGCTGGATAG
Gene >Ophun1|6690
ATGGCCGACTTTGACCTCGACGCCTCGTTCATTCCAGCCCTGCACAAGCCCTCATCTCTGCTGCCGATAGCGAAA
CATCGCGAGAGCCTCCTCTACGTCATCGAGACGCACCCCGTGACTATCGTCCTCGGCCAGACCGGCTCGGGCAAG
ACGACACAGATACCGCAGTTTCTCTGGCACGCAGGCTGGTGCTCAGATGGCAAGATAATCGGCGTCACACAGGCA
GGTGTCGCCGCCAGGTTAACAGGCTGCTGAGCTCTGCTGACCGGGCAGCCGACGACAGCCTCGACGCGTTGCGGC
TACGACGGTGGCGCTTCGCGTCGCCGACGAGGTAGGATGCGAGATCGGGAAAGAGGTCGGCTATTCGATACGCTT
CGAGGACGTCACGTCGTCGGCAACGCGCATCAAGTTCCTCACCGATGGGCTCCTCGTTCGGGAAGCCCTCGTCGA
CCCTCTTCTGAGCAGGTACTCGGTAATCATGGTCGATGAGGCTCACGAGAGGTCGGCGAGCACCGACATCCTTTT
GGGACTTCTCAGCAAGATCATCAAGAAGCGATCCGATCTCCGGGTCGTCGTCAGCAGCGCCACACTGCAGGCTCA
AGAATTCTTCGACTACTTTACCCGTGGGGAACAGAAGCCGGATGGAGATGGTGAGGCGCGAGACGAGTCAGCCGC
CATTGTAAGCCTCGAGGGGCGGACGTATCCGATCGATGTCCTATATTTGCAGTCACCTGCTGAGGACTACGTTGA
GACGGCCATCGATACCGTTCTCCGCATTCACACCGACGAGGGCCCAGGCGACATATTGGTCTTTCTGACGGGCCG
CGAGCAGATTGATTATGCCGTCCAAGCCATCTCGGACAAGGCCGGCGAAGCAGACAGTCGATACGCGACGCTACA
GCCGCTGGCGCTTTACGCCGGACTATCGACGGAGCAGCAGATGTACGTCTTTGACAAGCCCCCAGAGGGTACACG
CAAAGTCATCTTCTCGACCAACATCGCCGAGGCGTCCGTCACCATCGACGGCATCGTCTTCGTCGTCGACTGCGG
CTTCGTGAAGCTGCGAGCCTACAACGCGGAGACGTGTATAGAGTCGCTCACGACGACTGCCGTGTCCAAGGCCTC
GGCGTCGCAGCGAGCTGGTCGCGCCGGTCGAACCAAGCCTGGAAAGTGTTTTCGGCTCTACACCGAAGAGGCCTA
CGAGGCACTGCAAGACGCCAACGTACCCGAGCTGCAGAGATCGAACCTCGCGCCGGTGGTGCTGCAGCTCAAAGC
CCTGGGCATCGACAACGTCGTCCGATTCGAGTTCCTATCGCGGCCGGCGGCGGGACTCATGGCCAAGGCGCTCGA
GCTGCTCTACGCGCTGGGCGCTCTGGACGGGTACGCAAAGCTCACGCGGCCCCTGGGACTGCGCATGGCAGAACT
GGCGGTGCCGCCCATGATGGCCAAGACGCTGCTGATGGCGCCGTCTATGGGCTGCCTCGGCGAGATACTCTCCAT
CGCGGCCATGGCCAGCCTCGGCGGCAGCGTGTGGTTCTACCACGACGGAGAGCAGAAGCGAATGGAGAGCTCAAG
GCGCAAGTTTGCCGCCGAAGAAGGCGACCAGCTGACGCTCCTCAACGTCTACGCTGCCTTTGCGGCCAAGGGCAA
GCAGCAGGCACGCTTCTGCCACGAGAACCACATCAACTACAAGGCCATGACTCGCGCCGTCAGCATCCGCGCGCA
ACTGAGGCGCTACCTCGAGCGATTCGGCGTCGCCGTCGACGACAAGACAGAAGGAGTCAAGGGAGACGACGGACG
CAACAAGTCGGAGCAGATACGGCGGTGCCTGACGGCCGGATTCTTTGCCCACGTGGCGCGGATGCAGCCCGACGG
CACGTTCCGCAACGTCGGCGGCGGGACGGTGCTTCATGCGCATCCGAGCTCGCTCCTGTTCAGCCGCAAGGCTGA
CTGGGTCATCTTCCACGAGGTTATGGAGACGGGCGACAAGACGTACATCCGGGATGTGACCAAGATCGAAAAGGG
ATGGCTGCTCGAGTACGCGCCCGAGTACTACCAGCTGAGCCGCGCCCGAGGCCCAGCAGCTGGATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail