Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6689
Gene name
LocationContig_751:3241..6597
Strand-
Gene length (bp)3356
Transcript length (bp)2571
Coding sequence length (bp)2571
Protein length (aa) 857

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07819 PGAP1 PGAP1-like protein 4.5E-84 176 404

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2USI0|BST1_ASPOR GPI inositol-deacylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bst1 PE=3 SV=2 3 698 0.0E+00
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 39 404 2.0E-144
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 106 404 4.0E-140
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 102 403 3.0E-122
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 40 403 4.0E-122
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2USI0|BST1_ASPOR GPI inositol-deacylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bst1 PE=3 SV=2 3 698 0.0E+00
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 39 404 2.0E-144
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 106 404 4.0E-140
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 102 403 3.0E-122
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 40 403 4.0E-122
sp|Q0UQV6|BST1_PHANO GPI inositol-deacylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BST1 PE=3 SV=2 104 403 4.0E-122
sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 71 403 5.0E-119
sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 18 403 1.0E-116
sp|Q6CIN9|BST1_KLULA GPI inositol-deacylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BST1 PE=3 SV=1 129 699 1.0E-88
sp|Q752Q2|BST1_ASHGO GPI inositol-deacylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BST1 PE=3 SV=2 110 698 2.0E-88
sp|Q6FLY9|BST1_CANGA GPI inositol-deacylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BST1 PE=3 SV=1 93 704 2.0E-87
sp|Q6BRG1|BST1_DEBHA GPI inositol-deacylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BST1 PE=3 SV=2 97 404 6.0E-85
sp|Q9UT41|BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bst1 PE=3 SV=1 131 403 8.0E-82
sp|P43571|BST1_YEAST GPI inositol-deacylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BST1 PE=1 SV=1 128 404 4.0E-77
sp|Q6BZU7|BST1B_YARLI GPI inositol-deacylase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1B PE=3 SV=1 124 424 6.0E-68
sp|Q6CF60|BST1C_YARLI Putative GPI inositol-deacylase C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1C PE=3 SV=1 152 448 2.0E-64
sp|Q6C2Z2|BST1A_YARLI GPI inositol-deacylase A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1A PE=3 SV=1 116 406 5.0E-64
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 414 707 2.0E-63
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 414 713 1.0E-59
sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 373 710 1.0E-57
sp|Q7SAM0|BST1_NEUCR GPI inositol-deacylase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bst-1 PE=3 SV=1 695 853 2.0E-56
sp|Q2H102|BST1_CHAGB GPI inositol-deacylase OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=BST1 PE=3 SV=2 695 853 2.0E-54
sp|Q0UQV6|BST1_PHANO GPI inositol-deacylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BST1 PE=3 SV=2 375 698 5.0E-53
sp|P0CM51|BST1_CRYNB GPI inositol-deacylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BST1 PE=3 SV=1 134 406 6.0E-52
sp|P0CM50|BST1_CRYNJ GPI inositol-deacylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BST1 PE=3 SV=1 134 406 7.0E-52
sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 351 698 1.0E-50
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 412 698 1.0E-49
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 351 698 7.0E-49
sp|Q4P782|BST1_USTMA GPI inositol-deacylase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BST1 PE=3 SV=1 97 404 4.0E-48
sp|Q0UQV6|BST1_PHANO GPI inositol-deacylase OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=BST1 PE=3 SV=2 695 851 3.0E-47
sp|Q1DWP9|BST1_COCIM GPI inositol-deacylase OS=Coccidioides immitis (strain RS) GN=BST1 PE=3 SV=1 679 851 2.0E-46
sp|Q4WGM4|BST1_ASPFU GPI inositol-deacylase OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bst1 PE=3 SV=1 695 851 4.0E-45
sp|Q0CIV4|BST1_ASPTN GPI inositol-deacylase OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=bst1 PE=3 SV=2 695 848 1.0E-43
sp|Q2USI0|BST1_ASPOR GPI inositol-deacylase OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=bst1 PE=3 SV=2 695 851 2.0E-42
sp|Q5AYC8|BST1_EMENI GPI inositol-deacylase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bst1 PE=3 SV=2 697 854 3.0E-42
sp|Q765A7|PGAP1_RAT GPI inositol-deacylase OS=Rattus norvegicus GN=Pgap1 PE=1 SV=1 106 411 9.0E-42
sp|Q3UUQ7|PGAP1_MOUSE GPI inositol-deacylase OS=Mus musculus GN=Pgap1 PE=1 SV=3 106 411 3.0E-41
sp|Q75T13|PGAP1_HUMAN GPI inositol-deacylase OS=Homo sapiens GN=PGAP1 PE=1 SV=1 106 411 7.0E-41
sp|Q66J01|PGAP1_XENLA GPI inositol-deacylase OS=Xenopus laevis GN=pgap1 PE=2 SV=1 131 404 7.0E-36
sp|Q59VP0|BST1_CANAL GPI inositol-deacylase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BST1 PE=3 SV=1 91 317 2.0E-35
sp|Q6BRG1|BST1_DEBHA GPI inositol-deacylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BST1 PE=3 SV=2 698 851 2.0E-29
sp|Q9UT41|BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bst1 PE=3 SV=1 697 852 4.0E-27
sp|Q9W495|PGAP1_DROME GPI inositol-deacylase OS=Drosophila melanogaster GN=CG3160 PE=1 SV=3 175 405 1.0E-23
sp|Q752Q2|BST1_ASHGO GPI inositol-deacylase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BST1 PE=3 SV=2 674 849 2.0E-18
sp|Q6CF60|BST1C_YARLI Putative GPI inositol-deacylase C OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1C PE=3 SV=1 694 848 1.0E-16
sp|Q6C2Z2|BST1A_YARLI GPI inositol-deacylase A OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1A PE=3 SV=1 690 842 1.0E-15
sp|P43571|BST1_YEAST GPI inositol-deacylase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BST1 PE=1 SV=1 706 852 5.0E-15
sp|Q6CIN9|BST1_KLULA GPI inositol-deacylase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BST1 PE=3 SV=1 702 850 2.0E-13
sp|Q6BZU7|BST1B_YARLI GPI inositol-deacylase B OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BST1B PE=3 SV=1 740 848 6.0E-13
sp|Q6FLY9|BST1_CANGA GPI inositol-deacylase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BST1 PE=3 SV=1 686 850 6.0E-10
sp|Q9UT41|BST1_SCHPO GPI inositol-deacylase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bst1 PE=3 SV=1 415 715 1.0E-09
sp|Q6BRG1|BST1_DEBHA GPI inositol-deacylase OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BST1 PE=3 SV=2 498 736 3.0E-09
[Show less]

GO

GO Term Description Terminal node
GO:0016788 hydrolase activity, acting on ester bonds Yes
GO:0003674 molecular_function No
GO:0003824 catalytic activity No
GO:0016787 hydrolase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

Domain # Start End Length
1 102 124 22
2 705 727 22
3 747 766 19
4 781 803 22
5 816 838 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6689
MTSCSSASTEDGDDYIQPDVIDDSTNAHTRSSLPSISKLQSRPSSKQSGRLGSIGWAHSHVQNGHDWRVPAQSPS
VAPPAAMSFGSIDSPPTLRRFRQGSKIVSPLVVVVASLGWALLFVIVRSLLRHGLEHKGCHMSYMRPSYVHHSDF
GTEYTRFATKYSLYLYREQGIDDDQLRGTPVLFIPGNAGSYKQVRPIAAEAANYYHNNLRDDGNSMLAGVRNLDF
FTVDFNEDITAFHGRTLLDQAEYLNEAVRYILSLYSDPQRAARDNQIPDPSAVVILGHSMGGVVARAMLTQPNYQ
SKSINSIITMAAPHARPPVTFDAQIVHIYDEINGYWRRAYAQKWANDNPLWHVTLVSIAGGSLDTVVPSDYASLE
SIVPETHGFTVFTSGIPTVWTSMDHQAILCHTKDLTPTSYLIPVPPPDLLGTKRFTFITDASLDLDAAEADLEVL
LCSVIPNALDLDGDRSPTHLGLAAGSTLFERLSCKSSAPDAIFLPAQSRSANAGDEQPQAQPYTYLQYGPEHLTD
HQFIVVRVLSEMSAFVLAEFSDARDFKIQHNATLAQLVTEGLVFDLQPDRPLVVDVSIMSAASALLVFKLEISVS
RCSGKRKMPTLIRQFLNKPYESKYFVNTRQASIWSDPICESPLTARLRLDIWASFGKLYMRYRTILAAFPLLVEA
MVLRKQFRVYDETGIFISFTQVLLFLVSTIIPYQFAYVVACLVQIFTVICAFRISTKLASVDSQNFYHYAHSILL
LMMWVLPINLPILAVWVRNLAVHWLTPFPSHHNVFCIIPFMLLVENLTAGSMVPQMRSWQRHVTNLVLIGTAFCV
AIYGVSHAYALHYLVNAVAAWLVYLHSTRHA*
Coding >Ophun1|6689
ATGACAAGCTGCTCCTCTGCGTCGACTGAAGACGGTGACGATTACATCCAGCCAGACGTCATCGACGACTCTACC
AACGCCCATACTCGAAGCAGCCTACCGTCCATCAGTAAATTGCAATCGCGTCCGTCGTCGAAGCAGAGCGGACGT
TTAGGGAGCATTGGATGGGCTCACAGCCATGTGCAAAATGGTCACGACTGGCGAGTTCCGGCACAGTCGCCCTCT
GTAGCGCCACCTGCTGCCATGTCTTTTGGGAGCATTGATTCCCCGCCTACCCTCCGACGGTTTCGACAGGGCTCA
AAGATTGTCAGTCCACTTGTCGTCGTTGTCGCTAGCCTCGGATGGGCGCTTCTGTTTGTCATTGTCAGATCCCTC
TTGCGACACGGCCTGGAGCACAAAGGCTGCCATATGTCCTACATGAGGCCTTCCTACGTACACCATTCGGATTTC
GGCACTGAGTACACCCGGTTCGCGACGAAGTACTCGCTATATCTCTACCGTGAGCAGGGAATTGATGACGACCAG
TTGCGTGGAACTCCGGTACTTTTCATACCTGGAAATGCTGGAAGCTACAAGCAAGTTCGACCGATAGCCGCCGAG
GCTGCCAATTACTATCATAATAATCTGCGTGACGACGGCAATTCAATGCTGGCTGGGGTCCGGAATCTCGACTTC
TTTACCGTCGACTTCAACGAGGACATCACTGCTTTCCACGGCCGAACACTTCTCGACCAAGCTGAGTATCTCAAC
GAGGCCGTCCGCTATATTCTGTCCCTGTACTCCGACCCTCAACGAGCCGCTCGCGATAACCAGATACCTGATCCT
TCGGCTGTTGTCATACTCGGTCATTCCATGGGTGGTGTTGTCGCCCGTGCAATGTTGACGCAGCCCAATTATCAG
TCCAAGTCCATCAATTCGATTATAACCATGGCTGCGCCACACGCTCGTCCGCCAGTCACGTTCGATGCCCAAATT
GTACACATCTACGACGAAATCAACGGGTACTGGCGACGTGCCTACGCGCAGAAATGGGCGAATGACAACCCATTG
TGGCATGTCACCCTTGTGTCCATCGCTGGTGGCAGCCTCGACACTGTCGTGCCCTCAGACTACGCAAGCCTCGAA
TCCATCGTACCCGAAACCCACGGCTTTACTGTCTTCACTTCCGGAATACCTACTGTCTGGACGAGTATGGATCAC
CAAGCCATCCTCTGCCACACGAAAGATTTGACCCCCACGTCCTACCTGATTCCGGTCCCGCCCCCGGATCTCCTC
GGCACCAAGCGCTTTACTTTCATCACGGACGCTTCATTGGATCTGGACGCTGCGGAGGCTGACCTCGAGGTTCTC
CTGTGCAGCGTTATCCCCAATGCTCTGGACTTGGACGGCGACCGGTCACCAACGCATTTGGGCTTGGCGGCGGGA
AGCACATTGTTCGAAAGGCTTTCCTGCAAGAGTTCTGCGCCGGACGCCATCTTCTTGCCAGCACAGTCCCGTTCT
GCTAATGCTGGAGATGAACAACCGCAGGCCCAGCCTTATACATATCTGCAATACGGACCTGAACACCTTACAGAC
CACCAGTTCATCGTGGTCAGGGTGCTGTCAGAGATGTCTGCATTTGTCCTTGCCGAGTTTAGTGATGCGCGAGAC
TTCAAAATTCAGCACAATGCGACTCTTGCTCAGCTTGTTACTGAGGGTCTTGTCTTCGACCTGCAGCCTGACCGG
CCTCTCGTGGTCGACGTCAGCATCATGTCCGCTGCGTCGGCTTTGCTGGTCTTCAAGCTTGAAATCAGTGTTTCA
CGGTGTTCTGGAAAACGGAAAATGCCTACGCTGATACGGCAATTTTTGAACAAGCCTTATGAGTCCAAGTATTTC
GTCAATACTAGGCAAGCCAGTATCTGGTCTGATCCGATCTGCGAGTCGCCGCTCACAGCGCGGCTGAGGCTCGAT
ATTTGGGCCAGCTTTGGCAAACTGTACATGCGTTACCGAACCATTCTCGCTGCCTTTCCTTTGCTCGTGGAGGCC
ATGGTGCTCCGAAAGCAGTTTCGTGTATATGACGAGACGGGCATCTTCATCTCCTTTACTCAAGTTCTGCTCTTC
CTGGTATCTACTATTATACCGTATCAGTTCGCCTACGTGGTGGCCTGCCTCGTTCAGATATTCACCGTCATCTGC
GCTTTTCGGATCAGCACGAAGCTGGCGTCAGTCGACAGCCAGAACTTCTACCATTACGCCCACTCCATCCTCCTC
CTGATGATGTGGGTTCTCCCCATCAACCTACCCATTCTCGCCGTGTGGGTGCGCAATCTTGCCGTACATTGGCTC
ACACCTTTTCCCTCGCATCACAACGTCTTCTGCATCATACCCTTCATGCTTTTGGTGGAAAACCTCACAGCTGGC
AGCATGGTTCCGCAGATGAGGAGCTGGCAACGCCATGTCACGAATCTTGTCCTGATCGGAACTGCCTTCTGCGTC
GCTATTTATGGCGTGTCGCACGCATATGCCTTACACTATCTGGTCAACGCGGTGGCTGCGTGGCTCGTCTATCTC
CACTCGACAAGACACGCCTGA
Transcript >Ophun1|6689
ATGACAAGCTGCTCCTCTGCGTCGACTGAAGACGGTGACGATTACATCCAGCCAGACGTCATCGACGACTCTACC
AACGCCCATACTCGAAGCAGCCTACCGTCCATCAGTAAATTGCAATCGCGTCCGTCGTCGAAGCAGAGCGGACGT
TTAGGGAGCATTGGATGGGCTCACAGCCATGTGCAAAATGGTCACGACTGGCGAGTTCCGGCACAGTCGCCCTCT
GTAGCGCCACCTGCTGCCATGTCTTTTGGGAGCATTGATTCCCCGCCTACCCTCCGACGGTTTCGACAGGGCTCA
AAGATTGTCAGTCCACTTGTCGTCGTTGTCGCTAGCCTCGGATGGGCGCTTCTGTTTGTCATTGTCAGATCCCTC
TTGCGACACGGCCTGGAGCACAAAGGCTGCCATATGTCCTACATGAGGCCTTCCTACGTACACCATTCGGATTTC
GGCACTGAGTACACCCGGTTCGCGACGAAGTACTCGCTATATCTCTACCGTGAGCAGGGAATTGATGACGACCAG
TTGCGTGGAACTCCGGTACTTTTCATACCTGGAAATGCTGGAAGCTACAAGCAAGTTCGACCGATAGCCGCCGAG
GCTGCCAATTACTATCATAATAATCTGCGTGACGACGGCAATTCAATGCTGGCTGGGGTCCGGAATCTCGACTTC
TTTACCGTCGACTTCAACGAGGACATCACTGCTTTCCACGGCCGAACACTTCTCGACCAAGCTGAGTATCTCAAC
GAGGCCGTCCGCTATATTCTGTCCCTGTACTCCGACCCTCAACGAGCCGCTCGCGATAACCAGATACCTGATCCT
TCGGCTGTTGTCATACTCGGTCATTCCATGGGTGGTGTTGTCGCCCGTGCAATGTTGACGCAGCCCAATTATCAG
TCCAAGTCCATCAATTCGATTATAACCATGGCTGCGCCACACGCTCGTCCGCCAGTCACGTTCGATGCCCAAATT
GTACACATCTACGACGAAATCAACGGGTACTGGCGACGTGCCTACGCGCAGAAATGGGCGAATGACAACCCATTG
TGGCATGTCACCCTTGTGTCCATCGCTGGTGGCAGCCTCGACACTGTCGTGCCCTCAGACTACGCAAGCCTCGAA
TCCATCGTACCCGAAACCCACGGCTTTACTGTCTTCACTTCCGGAATACCTACTGTCTGGACGAGTATGGATCAC
CAAGCCATCCTCTGCCACACGAAAGATTTGACCCCCACGTCCTACCTGATTCCGGTCCCGCCCCCGGATCTCCTC
GGCACCAAGCGCTTTACTTTCATCACGGACGCTTCATTGGATCTGGACGCTGCGGAGGCTGACCTCGAGGTTCTC
CTGTGCAGCGTTATCCCCAATGCTCTGGACTTGGACGGCGACCGGTCACCAACGCATTTGGGCTTGGCGGCGGGA
AGCACATTGTTCGAAAGGCTTTCCTGCAAGAGTTCTGCGCCGGACGCCATCTTCTTGCCAGCACAGTCCCGTTCT
GCTAATGCTGGAGATGAACAACCGCAGGCCCAGCCTTATACATATCTGCAATACGGACCTGAACACCTTACAGAC
CACCAGTTCATCGTGGTCAGGGTGCTGTCAGAGATGTCTGCATTTGTCCTTGCCGAGTTTAGTGATGCGCGAGAC
TTCAAAATTCAGCACAATGCGACTCTTGCTCAGCTTGTTACTGAGGGTCTTGTCTTCGACCTGCAGCCTGACCGG
CCTCTCGTGGTCGACGTCAGCATCATGTCCGCTGCGTCGGCTTTGCTGGTCTTCAAGCTTGAAATCAGTGTTTCA
CGGTGTTCTGGAAAACGGAAAATGCCTACGCTGATACGGCAATTTTTGAACAAGCCTTATGAGTCCAAGTATTTC
GTCAATACTAGGCAAGCCAGTATCTGGTCTGATCCGATCTGCGAGTCGCCGCTCACAGCGCGGCTGAGGCTCGAT
ATTTGGGCCAGCTTTGGCAAACTGTACATGCGTTACCGAACCATTCTCGCTGCCTTTCCTTTGCTCGTGGAGGCC
ATGGTGCTCCGAAAGCAGTTTCGTGTATATGACGAGACGGGCATCTTCATCTCCTTTACTCAAGTTCTGCTCTTC
CTGGTATCTACTATTATACCGTATCAGTTCGCCTACGTGGTGGCCTGCCTCGTTCAGATATTCACCGTCATCTGC
GCTTTTCGGATCAGCACGAAGCTGGCGTCAGTCGACAGCCAGAACTTCTACCATTACGCCCACTCCATCCTCCTC
CTGATGATGTGGGTTCTCCCCATCAACCTACCCATTCTCGCCGTGTGGGTGCGCAATCTTGCCGTACATTGGCTC
ACACCTTTTCCCTCGCATCACAACGTCTTCTGCATCATACCCTTCATGCTTTTGGTGGAAAACCTCACAGCTGGC
AGCATGGTTCCGCAGATGAGGAGCTGGCAACGCCATGTCACGAATCTTGTCCTGATCGGAACTGCCTTCTGCGTC
GCTATTTATGGCGTGTCGCACGCATATGCCTTACACTATCTGGTCAACGCGGTGGCTGCGTGGCTCGTCTATCTC
CACTCGACAAGACACGCCTGA
Gene >Ophun1|6689
ATGACAAGCTGCTCCTCTGCGTCGACTGAAGACGGTGACGATTACATCCAGCCAGACGTCATCGACGACTCTACC
AACGCCCATACTCGAAGCAGCCTACCGTCCATCAGTAAATTGCAATCGCGTCCGTCGTCGAAGCAGAGCGGACGT
TTAGGGAGCATTGGATGGGCTCACAGCCATGTGCAAAATGGTCACGACTGGCGAGTTCCGGCACAGTCGCCCTCT
GTAGCGCCACCTGCTGCCATGTCTTTTGGGAGCATTGATTCCCCGCCTACCCTCCGACGGTTTCGACAGGGCTCA
AAGATTGTCAGTCCACTTGTCGTCGTTGTCGCTAGCCTCGGATGGGCGCTTCTGTTTGTCATTGTCAGATCCCTC
TTGCGACACGGCCTGGAGCACAAAGGCTGCCATATGTCCTACATGAGGCCTTCCTACGTACACCATTCGGATTTC
GGCACTGAGTACACCCGGTTCGCGACGAAGTACTCGCTATATCTCTACCGTGAGCAGGGAATTGATGACGACCAG
GTGTGTAATGTAGAGGCTTCATCTTCCCTGACGACAGGGGTCACTGGGCGTTTTCTTTTAACCTCGTCGGGCAGT
TGCGTGGAACTCCGGTACTTTTCATACCTGGAAATGCTGGAAGCTACAAGCAAGTTCGACCGATAGCCGCCGAGG
CTGCCAATTACTATCATAATAATCTGCGTGACGACGGCAATTCAATGCTGGCTGGGGTCCGGAATCTCGACTTCT
TTACCGTCGACTTCAACGAGGACATCACTGCTTTCCACGGCCGAACACTTCTCGACCAAGCTGAGTATCTCAACG
AGGCCGTCCGCTATATTCTGTCCCTGTACTCCGACCCTCAACGAGCCGCTCGCGATAACCAGATACCTGATCCTT
CGGCTGTTGTCATACTCGGTCATTCCATGGGTGGTGTTGTCGCCCGTGCAATGTTGACGCAGCCCAATTATCAGT
CCAAGTCCATCAATTCGATTATAACCATGGCTGCGCCACACGCTCGTCCGCCAGTCACGTTCGATGCCCAAATTG
TACACATCTACGACGAAATCAACGGGTACTGGCGACGTGCCTACGCGCAGAAATGGGCGAATGACAACCCATTGT
GGCATGTCACCCTTGTGTCCATCGCTGGTGGCAGCCTCGACACTGTCGTGCCCTCAGACTACGCAAGCCTCGAAT
CCATCGTACCCGAAACCCACGGCTTTACTGTCTTCACTTCCGGAATACCTACTGTCTGGACGAGTATGGATCACC
AAGCCATCCTCTGGTGTGACCAATTTCGGAAAGTGGTTGCTCGAGCGCTATACGATATAGTGGATGTGACTCGAG
CATCTCAGACGAAGCCAAGGGCCGATAGGATGCGACTCTTGAAGCGACGATTTCTTCCAGGCATGGAAATTGACG
CGGAGAAAGTAGCTACCCTCCGGCATGGTTCAACACCACTCAGCACAATTGATGGCTCAAGCAAATTCGTATTAG
CTGGACCGAGGCTTTCTCTCGGCAGCCACACGAAAGATTTGACCCCCACGTCCTACCTGATTCCGGTCCCGCCCC
CGGATCTCCTCGGCACCAAGCGCTTTACTTTCATCACGGACGCTTCATTGGATCTGGACGCTGCGGAGGCTGACC
TCGAGGTTCTCCTGTGCAGCGTTATCCCCAATGCTCTGGACTTGGACGGCGACCGGTCACCAACGCATTTGGGCT
TGGCGGCGGGAAGCACATTGTTCGAAAGGCTTTCCTGCAAGAGTTCTGCGCCGGACGCCATCTTCTTGCCAGCAC
AGTCCCGTTCTGCTAATGCTGGAGATGAACAACCGCAGGCCCAGCCTTATACATATCTGCAATACGGACCTGAAC
ACCTTACAGACCACCAGTTCATCGTGGTCAGGGTGCTGTCAGAGATGTCTGCATTTGTCCTTGCCGAGTTTAGTG
ATGCGCGAGACTTCAAAATTCAGCACAATGCGACTCTTGCTCAGCTTGTTACTGAGGGTCTTGTCTTCGACCTGC
AGCCTGACCGGCCTCTCGTGGTCGACGTCAGCATCATGTCCGCTGCGTCGGCTTTGCTGGTCTTCAAGCTTGAAA
TCAGTGTTTCACGGTGTTCTGGAAAACGGAAAATGCCTACGCTGATACGGCAATTTTTGAACAAGCCTTATGAGT
CCAAGTATTTCGTCAATACTAGGCAAGCCAGTGTCAGTCTCCATGGGAAAGCTCCCTTTCTCCCGCCACCCCTGG
AATCAGCAAGAGAAGTCGGCCTCACACTTCAGATCTGGTCTGATCCGATCTGCGAGTCGCCGCTCACAGCGCGGC
TGAGGCTCGATATTTGGGCCAGCTTTGGCAAACTGTACATGCGTTACCGAACCATTCTCGCTGCCTTTCCTTTGC
TCGTGGAGGCCATGGTGCTCCGAAAGCAGTTTCGTGTATATGACGAGACGGGCATCTTCATCTCCTTTACTCAAG
GTCTGGACCAGTCCCTTCGGAGGTCCATACCCCTTCTACTTCTTTGCCTCACACTGCTGTCTTCTTCCGTCGGTG
CCTCCTCCTTCTTCGGTTCATTTTCGAGACCGGAGGGTGCCAGCCAGCTTTATTCTAAGGATCGCGGATTTCACC
GAAACGAGCTGCTCTTAGGAACCGAGGACCTTCTCTTTTGCCTATTGATACCCCTCATCGGTATGGTCTGCGTTG
GGGTGTGCACAATTCTCCATTGTGTCATGGTCTGTTTCACACGAGCAATGAGCCTGTTGATTGGCTTCGTCAGCG
GTGGCTCGCCAAGCGAAGCAAGGGCTGCCCGGCAACCTCGACCGTTTCCGATCAGCCTTCTGTCCTTCACATCGC
CGAGGAGGATGGTATTCAGCGCAGTTCTGCTCTTCCTGGTATCTACTATTATACCGTATCAGTTCGCCTACGTGG
TGGCCTGCCTCGTTCAGATATTCACCGTCATCTGCGCTTTTCGGATCAGCACGAAGCTGGCGTCAGTCGACAGCC
AGAACTTCTACCATTACGCCCACTCCATCCTCCTCCTGATGATGTGGGTTCTCCCCATCAACCTACCCATTCTCG
CCGTGTGGGTGCGCAATCTTGCCGTACATTGGCTCACACCTTTTCCCTCGCATCACAACGTCTTCTGCATCATAC
CCTTCATGCTTTTGGTGGAAAACCTCACAGCTGGCAGCATGGTTCCGCAGATGAGGAGCTGGCAACGCCATGTCA
CGAATCTTGTCCTGATCGGAACTGCCTTCTGCGTCGCTATTTATGGCGTGTCGCACGCATATGCCTTACACTATC
TGGTCAACGCGGTGGCTGCGTGGCTCGTCTATCTCCACTCGACAAGACACGCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail