Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6688
Gene name
LocationContig_751:1004..2789
Strand+
Gene length (bp)1785
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07690 MFS_1 Major Facilitator Superfamily 8.9E-15 22 301
PF06813 Nodulin-like Nodulin-like 1.7E-14 16 196

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 16 190 4.0E-17
sp|Q4IM48|MCH1_GIBZE Probable transporter MCH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCH1 PE=3 SV=1 3 208 8.0E-13
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 213 334 3.0E-09
sp|Q9P3K8|MCH1_NEUCR Probable transporter mch1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mch1 PE=3 SV=1 3 164 4.0E-09
sp|Q59MJ2|MCH1_CANAL Probable transporter MCH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCH1 PE=3 SV=1 8 155 4.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 16 190 4.0E-17
sp|Q4IM48|MCH1_GIBZE Probable transporter MCH1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=MCH1 PE=3 SV=1 3 208 8.0E-13
sp|Q03795|YM30_YEAST Uncharacterized membrane protein YMR155W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YMR155W PE=1 SV=1 213 334 3.0E-09
sp|Q9P3K8|MCH1_NEUCR Probable transporter mch1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mch1 PE=3 SV=1 3 164 4.0E-09
sp|Q59MJ2|MCH1_CANAL Probable transporter MCH1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MCH1 PE=3 SV=1 8 155 4.0E-08
sp|Q6BN11|MCH1_DEBHA Probable transporter MCH1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=MCH1 PE=3 SV=2 23 174 1.0E-06
sp|Q4WVT3|MCH1_ASPFU Probable transporter mch1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=mch1 PE=3 SV=1 11 164 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0006810 transport No
GO:0008150 biological_process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 33 0.5

Transmembrane Domains

Domain # Start End Length
1 12 34 22
2 49 71 22
3 78 95 17
4 105 127 22
5 134 156 22
6 171 190 19
7 252 274 22
8 284 306 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6688
MVQQESHNGRRIAAGVAATLISLACGTNYVYSAWAPQFAERLGLSSTESNFIGSFGNLGVYSLGVPVGIVLDRSG
PRVFVLLGSALLAAGYFALHQAYDSGSGYVPALCFYSFVTGLGSCMAFAAAVKTSALNWPHHRGTATAFPVAAFG
LSAFFFSSLGSVLFPGDPSAFLKLLSWGTFCCTLIGFFFLRTSPQAAYHPLACSDIHSPPDTVSSGSANRAPPGA
SKSSGLWPTESGVGSDFLAKRLHASRIWCLAIACVVFLAAQVSALVIQNPNFLGFVSGFSGLGYGLLFGVFPSLV
TEAFGIRGLSQNWGFMTLAPVLSSSLFNLFYGQPAITQHTGYRSELVVRGFASLYTPYIMSDQP*
Coding >Ophun1|6688
ATGGTTCAACAAGAATCCCATAACGGCAGGAGGATTGCCGCTGGCGTTGCGGCAACGCTCATCTCCCTCGCATGT
GGCACAAATTACGTCTACTCGGCATGGGCTCCGCAGTTTGCAGAACGACTCGGCCTCTCATCGACGGAAAGTAAC
TTCATCGGCTCTTTCGGTAATCTAGGCGTCTATTCACTGGGCGTCCCCGTCGGCATCGTTCTTGATCGGAGCGGT
CCGCGAGTCTTCGTCCTCCTAGGGTCTGCTCTGCTTGCGGCCGGCTACTTCGCGCTGCACCAGGCATATGACTCG
GGTTCGGGCTATGTGCCTGCTCTATGCTTTTATTCCTTCGTCACCGGCCTCGGAAGCTGCATGGCCTTCGCCGCC
GCTGTCAAGACGTCGGCCCTCAACTGGCCGCATCACCGCGGCACTGCCACTGCTTTTCCCGTCGCCGCCTTCGGC
CTCAGTGCCTTCTTCTTCTCATCTTTGGGTTCCGTCCTCTTCCCCGGCGACCCTAGCGCTTTTCTGAAGCTCCTC
TCCTGGGGCACTTTTTGCTGTACCTTGATCGGCTTCTTCTTCCTCCGAACCTCGCCTCAAGCCGCATATCACCCT
TTGGCTTGTTCCGACATCCATTCTCCGCCCGATACCGTCAGTAGCGGTTCCGCAAACCGCGCGCCCCCCGGCGCA
TCCAAATCTTCGGGCTTGTGGCCTACAGAATCCGGCGTCGGATCCGACTTCCTAGCCAAGCGCCTTCATGCCAGC
CGAATCTGGTGCCTGGCCATTGCTTGCGTTGTGTTTCTCGCTGCGCAAGTCTCTGCTCTAGTCATACAGAACCCC
AACTTCTTGGGATTTGTCTCTGGCTTTTCCGGCCTTGGCTACGGGCTTCTGTTCGGTGTCTTTCCTTCTCTGGTC
ACCGAGGCCTTTGGCATCCGAGGTCTGAGCCAAAACTGGGGATTCATGACGCTAGCTCCCGTCTTGTCATCTAGC
CTGTTCAATCTGTTCTACGGTCAGCCTGCTATTACGCAGCATACTGGATATCGTTCGGAGCTTGTTGTACGGGGC
TTTGCCTCGTTGTATACGCCTTATATCATGAGCGATCAGCCTTAG
Transcript >Ophun1|6688
ATGGTTCAACAAGAATCCCATAACGGCAGGAGGATTGCCGCTGGCGTTGCGGCAACGCTCATCTCCCTCGCATGT
GGCACAAATTACGTCTACTCGGCATGGGCTCCGCAGTTTGCAGAACGACTCGGCCTCTCATCGACGGAAAGTAAC
TTCATCGGCTCTTTCGGTAATCTAGGCGTCTATTCACTGGGCGTCCCCGTCGGCATCGTTCTTGATCGGAGCGGT
CCGCGAGTCTTCGTCCTCCTAGGGTCTGCTCTGCTTGCGGCCGGCTACTTCGCGCTGCACCAGGCATATGACTCG
GGTTCGGGCTATGTGCCTGCTCTATGCTTTTATTCCTTCGTCACCGGCCTCGGAAGCTGCATGGCCTTCGCCGCC
GCTGTCAAGACGTCGGCCCTCAACTGGCCGCATCACCGCGGCACTGCCACTGCTTTTCCCGTCGCCGCCTTCGGC
CTCAGTGCCTTCTTCTTCTCATCTTTGGGTTCCGTCCTCTTCCCCGGCGACCCTAGCGCTTTTCTGAAGCTCCTC
TCCTGGGGCACTTTTTGCTGTACCTTGATCGGCTTCTTCTTCCTCCGAACCTCGCCTCAAGCCGCATATCACCCT
TTGGCTTGTTCCGACATCCATTCTCCGCCCGATACCGTCAGTAGCGGTTCCGCAAACCGCGCGCCCCCCGGCGCA
TCCAAATCTTCGGGCTTGTGGCCTACAGAATCCGGCGTCGGATCCGACTTCCTAGCCAAGCGCCTTCATGCCAGC
CGAATCTGGTGCCTGGCCATTGCTTGCGTTGTGTTTCTCGCTGCGCAAGTCTCTGCTCTAGTCATACAGAACCCC
AACTTCTTGGGATTTGTCTCTGGCTTTTCCGGCCTTGGCTACGGGCTTCTGTTCGGTGTCTTTCCTTCTCTGGTC
ACCGAGGCCTTTGGCATCCGAGGTCTGAGCCAAAACTGGGGATTCATGACGCTAGCTCCCGTCTTGTCATCTAGC
CTGTTCAATCTGTTCTACGGTCAGCCTGCTATTACGCAGCATACTGGATATCGTTCGGAGCTTGTTGTACGGGGC
TTTGCCTCGTTGTATACGCCTTATATCATGAGCGATCAGCCTTAG
Gene >Ophun1|6688
ATGGTTCAACAAGAATCCCATAACGGCAGGAGGATTGCCGCTGGCGTTGCGGCAACGCTCATCTCCCTCGCATGT
GGCACAAATGTACCTACCCAAATTCCCTGCCTGACCTGCTCCATGCTGCTGCTAAAGCCCCGGCAGTACGTCTAC
TCGGCATGGGCTCCGCAGTTTGCAGAACGACTCGGCCTCTCATCGACGGAAAGTAACTTCATCGGCTCTTTCGGT
AATCTAGGCGTCTATTCACTGGGCGTCCCCGTCGGCATCGTTCTTGATCGGAGCGGTCCGCGAGTCTTCGTCCTC
CTAGGGTCTGCTCTGCTTGCGGCCGGCTACTTCGCGCTGCACCAGGCATATGACTCGGGTTCGGGCTATGTGCCT
GCTCTATGCTTTTATTCCTTCGTCACCGGCCTCGGAAGCTGCATGGCCTTCGCCGCCGCTGTCAAGACGTCGGCC
CTCAACTGGCCGCATCACCGCGGCACTGCCACTGCTTTTCCCGTCGCCGCCTTCGGCCTCAGTGCCTTCTTCTTC
TCATCTTTGGGTTCCGTCCTCTTCCCCGGCGACCCTAGCGCTTTTCTGAAGCTCCTCTCCTGGGGCACTTTTTGC
TGTACCTTGATCGGCTTCTTCTTCCTCCGAACCTCGCCTCAAGCCGCATATCACCCTTTGGCTTGTTCCGACATC
CATTCTCCGCCCGATACCGTCAGTAGCGGTTCCGCAAACCGCGCGCCCCCCGGCGCATCCAAATCTTCGGGCTTG
TGGCCTACAGAATCCGGTACGTCTTCTGGTGAAAGCATTGATACGACACCCAGAGCCCAATCCTATGTCGAGCCA
GGTAGTGGAACTATTCCGGGCGAAGATCAGGGCGATATCGATGAAACGTCCTCGTTAGCCAGGCCGACCACAAGC
AGTCTTGATTCGGATCGTGGCTACCAAATAGACATTCGTGGCTGCAAACTCTTGCGAACGCTGTCGTTCTGGTTG
TTATTCTCTATCATGGCCCTCCTCGCTGGGGTCGGCCTTATGACCATTAAGTATGAAGACTATCTGAAGTCACTG
GTTACTGTGCCGCGCGGTTCTCACTAATGCCTGGGTTTCATCGCAGCAATATTGGTAACGACGTCAATGCCTTGT
GGAAGCATTTTGATGGTTCTCTCAGCAAACCCTCCCTCGTCCACAAGCAGCAAGTGCATGTTTCTATCATATCTG
TTTGTAGTTTTCTTGGACGACTCATGAGCGGTAAGATTCCCCAAGTTGTCATCTTGATTGTTGCTACCAGCAGGG
AGGGGGGGAAGGCAGTGTAGAGACGCTCTACCAGTGCAAATCACTCATCTCTCATCTCTGCAGGCGTCGGATCCG
ACTTCCTAGCCAAGCGCCTTCATGCCAGCCGAATCTGGTGCCTGGCCATTGCTTGCGTTGTGTTTCTCGCTGCGC
AAGTCTCTGCTCTAGTCATACAGAACCCCAACTTCTTGGGATTTGTCTCTGGCTTTTCCGGCCTTGGCTACGGGC
TTCTGTTCGGTGTCTTTCCTTCTCTGGTCACCGAGGCCTTTGGCATCCGAGGTCTGAGCCAAAACTGGGGATTCA
TGACGCTAGCTCCCGTCTTGTCATCTAGCCTGTTCAATCTGTTCTACGGTCAGGTATATGACAGGCATAGCATTG
TTGATTCCGAAGGCAAGAGGTACTGCATCGAAGGCGTAGCCTGCTATTACGCAGCATACTGGATATCGTTCGGAG
CTTGTTGTACGGGGCTTTGCCTCGTTGTATACGCCTTATATCATGAGCGATCAGCCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail