Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6682
Gene name
LocationContig_75:37246..38455
Strand-
Gene length (bp)1209
Transcript length (bp)1041
Coding sequence length (bp)1041
Protein length (aa) 347

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09362 DUF1996 Domain of unknown function (DUF1996) 3.4E-69 35 266

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6062
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|01065
Ophiocordyceps camponoti-rufipedis Ophun1|6682 (this protein)
Ophiocordyceps kimflemingae Ophio5|3618
Ophiocordyceps subramaniannii Hirsu2|2323

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6682
MKLDKCAALAPFLFPSALGHIFTVNCKALTIQRGDPIVFPGVLSPHVHTVVGGTAFALTESNEDAKASRATTCDK
VLDNSNYWQPQLYHQRRDGKFELVEMQGIAAYYIDRACDYAPGRRNCDNTPHARAPPAGLRMVVGNPYLRTYDAS
NPEQRAISHICLGPGASDDTPHLPTKQCERLRAETFFPSCWDGTNLDSANHKSHMAFPAIGDYNTGVCPPSHPIA
ILSVFLEFFYDTAAIRDFNRWVWSMGDPTGYGLHGDFINGWSDQGALERAMDTCTGSSGVNDPHCSLNVGPGGPG
QPSLQSPQIAPPGEDVGLRGPLDRLPGDNPVTGSVVGGRNGTRFRA*
Coding >Ophun1|6682
ATGAAGCTCGACAAGTGTGCCGCTCTGGCTCCCTTCCTGTTCCCCAGCGCCCTCGGCCACATCTTTACCGTCAAC
TGCAAGGCCCTGACGATCCAGCGCGGAGACCCCATCGTCTTCCCCGGGGTTCTATCTCCGCACGTCCACACCGTC
GTCGGAGGCACTGCCTTTGCCCTGACGGAAAGCAACGAGGATGCCAAGGCCTCCAGGGCGACGACCTGTGACAAG
GTCCTGGACAATAGCAACTACTGGCAGCCTCAGCTCTACCATCAGCGGCGTGATGGCAAGTTTGAGCTGGTAGAG
ATGCAGGGGATCGCGGCCTACTACATTGATAGAGCCTGTGATTATGCTCCGGGCCGTCGAAACTGCGATAACACG
CCGCATGCTCGAGCACCGCCTGCGGGACTTCGGATGGTAGTGGGAAATCCATATCTTCGAACCTACGACGCTTCC
AACCCCGAGCAACGAGCCATCTCTCACATCTGCTTAGGCCCGGGCGCCTCGGATGACACGCCTCATCTGCCGACG
AAGCAGTGTGAGCGTCTCCGTGCTGAGACCTTTTTTCCCTCGTGCTGGGATGGAACGAACCTGGACAGCGCGAAC
CATAAGAGCCATATGGCATTCCCAGCCATCGGCGACTACAACACCGGCGTCTGCCCCCCCTCCCATCCCATAGCC
ATCCTCTCCGTCTTCCTCGAGTTCTTCTACGACACAGCAGCCATCCGGGACTTTAACCGCTGGGTATGGTCCATG
GGCGACCCGACCGGCTACGGCCTCCACGGCGACTTCATCAACGGATGGTCCGATCAAGGAGCATTGGAGCGGGCC
ATGGACACATGCACCGGTTCGTCGGGCGTCAACGATCCCCATTGCAGTCTGAACGTCGGACCAGGCGGACCCGGA
CAGCCGAGCCTGCAATCGCCGCAGATTGCGCCGCCCGGAGAAGATGTAGGCCTCCGGGGGCCTCTGGATAGGCTG
CCTGGAGACAACCCGGTTACGGGCTCGGTGGTTGGAGGGCGCAATGGGACGAGGTTTCGGGCATGA
Transcript >Ophun1|6682
ATGAAGCTCGACAAGTGTGCCGCTCTGGCTCCCTTCCTGTTCCCCAGCGCCCTCGGCCACATCTTTACCGTCAAC
TGCAAGGCCCTGACGATCCAGCGCGGAGACCCCATCGTCTTCCCCGGGGTTCTATCTCCGCACGTCCACACCGTC
GTCGGAGGCACTGCCTTTGCCCTGACGGAAAGCAACGAGGATGCCAAGGCCTCCAGGGCGACGACCTGTGACAAG
GTCCTGGACAATAGCAACTACTGGCAGCCTCAGCTCTACCATCAGCGGCGTGATGGCAAGTTTGAGCTGGTAGAG
ATGCAGGGGATCGCGGCCTACTACATTGATAGAGCCTGTGATTATGCTCCGGGCCGTCGAAACTGCGATAACACG
CCGCATGCTCGAGCACCGCCTGCGGGACTTCGGATGGTAGTGGGAAATCCATATCTTCGAACCTACGACGCTTCC
AACCCCGAGCAACGAGCCATCTCTCACATCTGCTTAGGCCCGGGCGCCTCGGATGACACGCCTCATCTGCCGACG
AAGCAGTGTGAGCGTCTCCGTGCTGAGACCTTTTTTCCCTCGTGCTGGGATGGAACGAACCTGGACAGCGCGAAC
CATAAGAGCCATATGGCATTCCCAGCCATCGGCGACTACAACACCGGCGTCTGCCCCCCCTCCCATCCCATAGCC
ATCCTCTCCGTCTTCCTCGAGTTCTTCTACGACACAGCAGCCATCCGGGACTTTAACCGCTGGGTATGGTCCATG
GGCGACCCGACCGGCTACGGCCTCCACGGCGACTTCATCAACGGATGGTCCGATCAAGGAGCATTGGAGCGGGCC
ATGGACACATGCACCGGTTCGTCGGGCGTCAACGATCCCCATTGCAGTCTGAACGTCGGACCAGGCGGACCCGGA
CAGCCGAGCCTGCAATCGCCGCAGATTGCGCCGCCCGGAGAAGATGTAGGCCTCCGGGGGCCTCTGGATAGGCTG
CCTGGAGACAACCCGGTTACGGGCTCGGTGGTTGGAGGGCGCAATGGGACGAGGTTTCGGGCATGA
Gene >Ophun1|6682
ATGAAGCTCGACAAGTGTGCCGCTCTGGCTCCCTTCCTGTTCCCCAGCGCCCTCGGCCACATCTTTACCGTCAAC
TGCAAGGCCCTGACGATCCAGCGCGGAGACCCCATCGTCTTCCCCGGGGTTCTATCTCCGCACGTCCACACCGTC
GTCGGAGGCACTGCCTTTGCCCTGACGGAAAGCAACGAGGATGCCAAGGCCTCCAGGGCGACGACCTGTGACAAG
GTCCTGGACAATAGCAACTACTGGCAGCCTCAGCTCTACCATCAGCGGCGTGATGGCAAGTTTGAGCTGGTAGAG
ATGCAGGGGATCGTGAGTCTGCCGTCTCGGCCCGCTGCTGTTGGTTGGGCACTGACGAGCCTGTTTCACAGGCGG
CCTACTACATTGATAGAGCCTGTGATTATGCTCCGGGCCGTCGAAACTGCGATAACACGCCGCATGCTCGAGCAC
CGCCTGCGGGACTTCGGATGGTAGTGGGAAATCCATATCTTCGGTCAGTTATAAGACCATCTCGGCCTGACAGAG
CCCGAACTAACAACAAAAGAACCTACGACGCTTCCAACCCCGAGCAACGAGCCATCTCTCACATCTGCTTAGGCC
CGGGCGCCTCGGATGACACGCCTCATCTGCCGACGAAGCAGTGTGAGCGTCTCCGTGCTGAGACCTTTTTTCCCT
CGTGCTGGGATGGAACGAACCTGGACAGCGCGAACCATAAGAGCCATGTAAGTAGATTAAAGACGACTTCAATCA
GATCAGCTGCTGATATGAATGGTGCTCTAGATGGCATTCCCAGCCATCGGCGACTACAACACCGGCGTCTGCCCC
CCCTCCCATCCCATAGCCATCCTCTCCGTCTTCCTCGAGTTCTTCTACGACACAGCAGCCATCCGGGACTTTAAC
CGCTGGGTATGGTCCATGGGCGACCCGACCGGCTACGGCCTCCACGGCGACTTCATCAACGGATGGTCCGATCAA
GGAGCATTGGAGCGGGCCATGGACACATGCACCGGTTCGTCGGGCGTCAACGATCCCCATTGCAGTCTGAACGTC
GGACCAGGCGGACCCGGACAGCCGAGCCTGCAATCGCCGCAGATTGCGCCGCCCGGAGAAGATGTAGGCCTCCGG
GGGCCTCTGGATAGGCTGCCTGGAGACAACCCGGTTACGGGCTCGGTGGTTGGAGGGCGCAATGGGACGAGGTTT
CGGGCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail