Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6675
Gene name
LocationContig_75:22147..25890
Strand+
Gene length (bp)3743
Transcript length (bp)3375
Coding sequence length (bp)3375
Protein length (aa) 1125

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00122 E1-E2_ATPase E1-E2 ATPase 6.1E-40 230 428
PF00689 Cation_ATPase_C Cation transporting ATPase, C-terminus 7.3E-34 907 1109
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.7E-12 445 732
PF00702 Hydrolase haloacid dehalogenase-like hydrolase 1.5E-07 795 838
PF13246 Cation_ATPase Cation transport ATPase (P-type) 2.5E-14 501 612
PF00690 Cation_ATPase_N Cation transporter/ATPase, N-terminus 1.1E-10 95 162

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 92 1124 4.0E-169
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 68 1124 8.0E-168
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 68 1124 1.0E-167
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 68 1124 1.0E-167
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 68 1124 2.0E-167
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P17326|AT1A_ARTSF Sodium/potassium-transporting ATPase subunit alpha-A OS=Artemia franciscana PE=2 SV=1 92 1124 4.0E-169
sp|P05024|AT1A1_PIG Sodium/potassium-transporting ATPase subunit alpha-1 OS=Sus scrofa GN=ATP1A1 PE=1 SV=1 68 1124 8.0E-168
sp|Q08DA1|AT1A1_BOVIN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Bos taurus GN=ATP1A1 PE=2 SV=1 68 1124 1.0E-167
sp|P18907|AT1A1_HORSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Equus caballus GN=ATP1A1 PE=3 SV=1 68 1124 1.0E-167
sp|P04074|AT1A1_SHEEP Sodium/potassium-transporting ATPase subunit alpha-1 OS=Ovis aries GN=ATP1A1 PE=1 SV=1 68 1124 2.0E-167
sp|P54708|AT12A_RAT Potassium-transporting ATPase alpha chain 2 OS=Rattus norvegicus GN=Atp12a PE=1 SV=1 68 1118 4.0E-167
sp|P13607|ATNA_DROME Sodium/potassium-transporting ATPase subunit alpha OS=Drosophila melanogaster GN=Atpalpha PE=1 SV=3 40 1124 5.0E-167
sp|P24798|AT1A3_CHICK Sodium/potassium-transporting ATPase subunit alpha-3 OS=Gallus gallus GN=ATP1A3 PE=2 SV=1 88 1124 1.0E-166
sp|P05023|AT1A1_HUMAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Homo sapiens GN=ATP1A1 PE=1 SV=1 81 1124 2.0E-166
sp|P50997|AT1A1_CANLF Sodium/potassium-transporting ATPase subunit alpha-1 OS=Canis lupus familiaris GN=ATP1A1 PE=2 SV=1 68 1124 3.0E-166
sp|Q5RDR3|AT1A1_PONAB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Pongo abelii GN=ATP1A1 PE=2 SV=1 81 1124 5.0E-166
sp|P13637|AT1A3_HUMAN Sodium/potassium-transporting ATPase subunit alpha-3 OS=Homo sapiens GN=ATP1A3 PE=1 SV=3 73 1124 6.0E-166
sp|Q9N0Z6|AT1A1_RABIT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oryctolagus cuniculus GN=ATP1A1 PE=1 SV=2 81 1124 7.0E-166
sp|P50993|AT1A2_HUMAN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Homo sapiens GN=ATP1A2 PE=1 SV=1 96 1124 2.0E-165
sp|P06686|AT1A2_RAT Sodium/potassium-transporting ATPase subunit alpha-2 OS=Rattus norvegicus GN=Atp1a2 PE=1 SV=1 96 1124 2.0E-165
sp|Q6PIE5|AT1A2_MOUSE Sodium/potassium-transporting ATPase subunit alpha-2 OS=Mus musculus GN=Atp1a2 PE=1 SV=1 96 1124 2.0E-165
sp|A2VDL6|AT1A2_BOVIN Sodium/potassium-transporting ATPase subunit alpha-2 OS=Bos taurus GN=ATP1A2 PE=2 SV=1 96 1124 4.0E-165
sp|D2WKD8|AT1A2_PIG Sodium/potassium-transporting ATPase subunit alpha-2 OS=Sus scrofa GN=ATP1A2 PE=1 SV=1 96 1124 7.0E-165
sp|Q5RCD8|AT1A2_PONAB Sodium/potassium-transporting ATPase subunit alpha-2 OS=Pongo abelii GN=ATP1A2 PE=2 SV=1 96 1124 7.0E-165
sp|P06687|AT1A3_RAT Sodium/potassium-transporting ATPase subunit alpha-3 OS=Rattus norvegicus GN=Atp1a3 PE=1 SV=2 88 1124 2.0E-164
sp|Q6PIC6|AT1A3_MOUSE Sodium/potassium-transporting ATPase subunit alpha-3 OS=Mus musculus GN=Atp1a3 PE=1 SV=1 88 1124 2.0E-164
sp|P06685|AT1A1_RAT Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rattus norvegicus GN=Atp1a1 PE=1 SV=1 81 1124 2.0E-164
sp|Q8VDN2|AT1A1_MOUSE Sodium/potassium-transporting ATPase subunit alpha-1 OS=Mus musculus GN=Atp1a1 PE=1 SV=1 81 1124 3.0E-164
sp|P35317|AT1A_HYDVU Sodium/potassium-transporting ATPase subunit alpha OS=Hydra vulgaris PE=2 SV=1 45 1124 8.0E-164
sp|P24797|AT1A2_CHICK Sodium/potassium-transporting ATPase subunit alpha-2 OS=Gallus gallus GN=ATP1A2 PE=2 SV=1 70 1124 9.0E-164
sp|P30714|AT1A1_RHIMB Sodium/potassium-transporting ATPase subunit alpha-1 OS=Rhinella marina GN=ATP1A1 PE=1 SV=2 93 1124 1.0E-163
sp|P28774|AT1B_ARTSF Sodium/potassium-transporting ATPase subunit alpha-B OS=Artemia franciscana PE=2 SV=1 69 1124 1.0E-163
sp|Q9Z1W8|AT12A_MOUSE Potassium-transporting ATPase alpha chain 2 OS=Mus musculus GN=Atp12a PE=1 SV=3 92 1118 1.0E-163
sp|Q64392|AT12A_CAVPO Potassium-transporting ATPase alpha chain 2 OS=Cavia porcellus GN=ATP12A PE=2 SV=1 67 1118 3.0E-163
sp|Q9TV52|AT12A_RABIT Potassium-transporting ATPase alpha chain 2 OS=Oryctolagus cuniculus GN=ATP12A PE=2 SV=1 70 1118 8.0E-163
sp|P58312|AT1A3_OREMO Sodium/potassium-transporting ATPase subunit alpha-3 OS=Oreochromis mossambicus GN=atp1a3 PE=2 SV=1 96 1124 3.0E-162
sp|Q9WV27|AT1A4_MOUSE Sodium/potassium-transporting ATPase subunit alpha-4 OS=Mus musculus GN=Atp1a4 PE=1 SV=3 88 1124 3.0E-162
sp|P09572|AT1A1_CHICK Sodium/potassium-transporting ATPase subunit alpha-1 OS=Gallus gallus GN=ATP1A1 PE=2 SV=1 70 1124 1.0E-161
sp|Q92030|AT1A1_ANGAN Sodium/potassium-transporting ATPase subunit alpha-1 OS=Anguilla anguilla GN=atp1a1 PE=2 SV=1 92 1124 6.0E-161
sp|P05025|AT1A_TORCA Sodium/potassium-transporting ATPase subunit alpha OS=Torpedo californica PE=1 SV=1 93 1124 6.0E-161
sp|Q64541|AT1A4_RAT Sodium/potassium-transporting ATPase subunit alpha-4 OS=Rattus norvegicus GN=Atp1a4 PE=2 SV=1 88 1124 1.0E-160
sp|Q92123|AT1A1_XENLA Sodium/potassium-transporting ATPase subunit alpha-1 OS=Xenopus laevis GN=atp1a1 PE=2 SV=1 93 1124 3.0E-160
sp|Q9YH26|AT1A1_OREMO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Oreochromis mossambicus GN=atp1a1 PE=2 SV=2 92 1124 6.0E-160
sp|Q92036|AT12A_RHIMB Potassium-transporting ATPase alpha chain 2 OS=Rhinella marina GN=ATP12A PE=2 SV=1 92 1118 2.0E-159
sp|Q6RWA9|AT1A_TAESO Sodium/potassium-transporting ATPase subunit alpha OS=Taenia solium PE=2 SV=1 70 1121 6.0E-159
sp|P25489|AT1A1_CATCO Sodium/potassium-transporting ATPase subunit alpha-1 OS=Catostomus commersonii GN=atp1a1 PE=2 SV=1 92 1124 8.0E-159
sp|Q92126|ATP4A_XENLA Potassium-transporting ATPase alpha chain 1 OS=Xenopus laevis GN=atp4a PE=2 SV=3 92 1124 7.0E-155
sp|Q13733|AT1A4_HUMAN Sodium/potassium-transporting ATPase subunit alpha-4 OS=Homo sapiens GN=ATP1A4 PE=1 SV=3 212 1124 7.0E-154
sp|P54707|AT12A_HUMAN Potassium-transporting ATPase alpha chain 2 OS=Homo sapiens GN=ATP12A PE=1 SV=3 93 1118 4.0E-153
sp|P50996|ATP4A_CANLF Potassium-transporting ATPase alpha chain 1 OS=Canis lupus familiaris GN=ATP4A PE=2 SV=3 96 1118 2.0E-147
sp|P09626|ATP4A_RAT Potassium-transporting ATPase alpha chain 1 OS=Rattus norvegicus GN=Atp4a PE=1 SV=3 96 1118 4.0E-147
sp|P27112|ATP4A_RABIT Potassium-transporting ATPase alpha chain 1 OS=Oryctolagus cuniculus GN=ATP4A PE=2 SV=3 96 1118 5.0E-147
sp|P20648|ATP4A_HUMAN Potassium-transporting ATPase alpha chain 1 OS=Homo sapiens GN=ATP4A PE=2 SV=5 96 1118 7.0E-147
sp|P19156|ATP4A_PIG Potassium-transporting ATPase alpha chain 1 OS=Sus scrofa GN=ATP4A PE=1 SV=3 96 1118 1.0E-146
sp|Q64436|ATP4A_MOUSE Potassium-transporting ATPase alpha chain 1 OS=Mus musculus GN=Atp4a PE=1 SV=3 96 1118 3.0E-145
sp|Q9YGL9|AT2A3_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Gallus gallus GN=ATP2A3 PE=2 SV=1 96 1114 1.0E-97
sp|O59868|ATC1_SCHPO Calcium-transporting ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmr1 PE=1 SV=1 197 1114 6.0E-96
sp|P54209|ATC1_DUNBI Cation-transporting ATPase CA1 OS=Dunaliella bioculata GN=CA1 PE=2 SV=1 200 1114 6.0E-95
sp|O34431|ATCL_BACSU Calcium-transporting ATPase OS=Bacillus subtilis (strain 168) GN=yloB PE=1 SV=1 93 1092 3.0E-92
sp|Q64518|AT2A3_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Mus musculus GN=Atp2a3 PE=1 SV=3 94 1116 2.0E-91
sp|P13586|ATC1_YEAST Calcium-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMR1 PE=1 SV=1 68 1116 2.0E-91
sp|P18596|AT2A3_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Rattus norvegicus GN=Atp2a3 PE=1 SV=2 94 1116 3.0E-91
sp|Q8Y8Q5|LMCA1_LISMO Calcium-transporting ATPase lmo0841 OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=lmo0841 PE=1 SV=1 108 949 1.0E-90
sp|P92939|ECA1_ARATH Calcium-transporting ATPase 1, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA1 PE=1 SV=2 87 1109 5.0E-90
sp|Q7PPA5|ATC1_ANOGA Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Anopheles gambiae GN=Ca-P60A PE=3 SV=5 96 1116 1.0E-89
sp|Q73E41|BACA1_BACC1 Calcium-transporting ATPase 1 OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=BCE_0519 PE=1 SV=1 95 1105 2.0E-89
sp|Q9XES1|ECA4_ARATH Calcium-transporting ATPase 4, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA4 PE=2 SV=2 102 1109 1.0E-88
sp|O43108|ATC1_YARLI Calcium-transporting ATPase 1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=PMR1 PE=3 SV=1 197 1114 1.0E-88
sp|P37278|ATCL_SYNE7 Calcium-transporting ATPase OS=Synechococcus elongatus (strain PCC 7942) GN=pacL PE=1 SV=2 94 1114 4.0E-88
sp|P35315|ATC_TRYBB Probable calcium-transporting ATPase OS=Trypanosoma brucei brucei GN=TBA1 PE=3 SV=1 209 1113 1.0E-87
sp|Q92105|AT2A1_PELES Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Pelophylax esculentus GN=ATP2A1 PE=2 SV=1 96 1113 3.0E-87
sp|P04191|AT2A1_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Oryctolagus cuniculus GN=ATP2A1 PE=1 SV=1 96 1112 3.0E-87
sp|P70083|AT2A1_MAKNI Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Makaira nigricans GN=atp2a1 PE=2 SV=2 96 1113 6.0E-86
sp|P13585|AT2A1_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Gallus gallus GN=ATP2A1 PE=2 SV=2 96 1113 7.0E-86
sp|P37367|ATA1_SYNY3 Cation-transporting ATPase pma1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pma1 PE=3 SV=2 96 979 9.0E-86
sp|Q93084|AT2A3_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 3 OS=Homo sapiens GN=ATP2A3 PE=1 SV=2 96 1114 2.0E-85
sp|Q8R429|AT2A1_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Mus musculus GN=Atp2a1 PE=1 SV=1 96 1112 6.0E-85
sp|Q0VCY0|AT2A1_BOVIN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Bos taurus GN=ATP2A1 PE=1 SV=1 96 1112 7.0E-85
sp|Q64578|AT2A1_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Rattus norvegicus GN=Atp2a1 PE=1 SV=1 96 1112 9.0E-85
sp|O14983|AT2A1_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 1 OS=Homo sapiens GN=ATP2A1 PE=1 SV=1 96 1112 4.0E-84
sp|Q9CFU9|LLCA1_LACLA Calcium-transporting ATPase 1 OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=yoaB PE=1 SV=1 178 974 5.0E-84
sp|P20647|AT2A2_RABIT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Oryctolagus cuniculus GN=ATP2A2 PE=2 SV=2 96 1113 2.0E-83
sp|Q292Q0|ATC1_DROPS Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila pseudoobscura pseudoobscura GN=Ca-P60A PE=3 SV=2 200 1116 2.0E-83
sp|Q00779|AT2A2_FELCA Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Felis catus GN=ATP2A2 PE=2 SV=1 96 1113 2.0E-83
sp|O46674|AT2A2_CANLF Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Canis lupus familiaris GN=ATP2A2 PE=2 SV=1 96 1113 7.0E-83
sp|P22700|ATC1_DROME Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Drosophila melanogaster GN=Ca-P60A PE=1 SV=2 200 1116 1.0E-82
sp|P16615|AT2A2_HUMAN Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Homo sapiens GN=ATP2A2 PE=1 SV=1 96 1113 2.0E-82
sp|Q9SY55|ECA3_ARATH Calcium-transporting ATPase 3, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA3 PE=2 SV=3 99 1113 4.0E-82
sp|A7L9Z8|AT2C2_MOUSE Calcium-transporting ATPase type 2C member 2 OS=Mus musculus GN=Atp2c2 PE=2 SV=1 197 1110 7.0E-82
sp|P11607|AT2A2_PIG Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Sus scrofa GN=ATP2A2 PE=1 SV=1 96 1113 9.0E-82
sp|Q8R4C1|AT2C2_RAT Calcium-transporting ATPase type 2C member 2 OS=Rattus norvegicus GN=Atp2c2 PE=2 SV=1 197 1084 1.0E-81
sp|Q03669|AT2A2_CHICK Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Gallus gallus GN=ATP2A2 PE=2 SV=2 96 1113 2.0E-81
sp|P11507|AT2A2_RAT Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Rattus norvegicus GN=Atp2a2 PE=1 SV=1 96 1123 4.0E-81
sp|O55143|AT2A2_MOUSE Sarcoplasmic/endoplasmic reticulum calcium ATPase 2 OS=Mus musculus GN=Atp2a2 PE=1 SV=2 96 1113 5.0E-81
sp|P35316|ATC_ARTSF Calcium-transporting ATPase sarcoplasmic/endoplasmic reticulum type OS=Artemia franciscana PE=2 SV=1 96 1118 9.0E-81
sp|Q42883|ECAP_SOLLC Calcium-transporting ATPase, endoplasmic reticulum-type OS=Solanum lycopersicum GN=LCA1 PE=2 SV=1 200 1114 2.0E-80
sp|P9WPS9|CTPF_MYCTU Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpF PE=1 SV=1 96 955 4.0E-80
sp|P9WPS8|CTPF_MYCTO Probable cation-transporting ATPase F OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpF PE=2 SV=1 96 955 4.0E-80
sp|P63688|CTPF_MYCBO Probable cation-transporting ATPase F OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpF PE=3 SV=1 96 955 4.0E-80
sp|Q64566|AT2C1_RAT Calcium-transporting ATPase type 2C member 1 OS=Rattus norvegicus GN=Atp2c1 PE=2 SV=1 185 1084 3.0E-78
sp|P98194|AT2C1_HUMAN Calcium-transporting ATPase type 2C member 1 OS=Homo sapiens GN=ATP2C1 PE=1 SV=3 185 1084 1.0E-77
sp|Q5R5K5|AT2C1_PONAB Calcium-transporting ATPase type 2C member 1 OS=Pongo abelii GN=ATP2C1 PE=2 SV=1 185 1084 1.0E-77
sp|P57709|AT2C1_BOVIN Calcium-transporting ATPase type 2C member 1 OS=Bos taurus GN=ATP2C1 PE=2 SV=1 185 1084 1.0E-77
sp|Q80XR2|AT2C1_MOUSE Calcium-transporting ATPase type 2C member 1 OS=Mus musculus GN=Atp2c1 PE=1 SV=2 216 1084 8.0E-77
sp|O75185|AT2C2_HUMAN Calcium-transporting ATPase type 2C member 2 OS=Homo sapiens GN=ATP2C2 PE=1 SV=2 215 960 1.0E-75
sp|Q2QMX9|ACA1_ORYSJ Calcium-transporting ATPase 1, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0586600 PE=2 SV=1 103 1034 7.0E-71
sp|O23087|ECA2_ARATH Calcium-transporting ATPase 2, endoplasmic reticulum-type OS=Arabidopsis thaliana GN=ECA2 PE=1 SV=1 201 1109 3.0E-69
sp|Q37145|ACA1_ARATH Calcium-transporting ATPase 1, chloroplastic OS=Arabidopsis thaliana GN=ACA1 PE=1 SV=3 23 1042 2.0E-68
sp|Q6ATV4|ACA2_ORYSJ Calcium-transporting ATPase 2, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os03g0616400 PE=2 SV=1 236 1034 2.0E-67
sp|O64806|ACA7_ARATH Putative calcium-transporting ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=ACA7 PE=3 SV=2 236 985 4.0E-63
sp|O81108|ACA2_ARATH Calcium-transporting ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=ACA2 PE=1 SV=1 23 1034 9.0E-63
sp|P47317|ATCL_MYCGE Probable cation-transporting P-type ATPase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=pacL PE=3 SV=1 200 887 1.0E-62
sp|P22189|ATC3_SCHPO Calcium-transporting ATPase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta3 PE=1 SV=1 102 948 2.0E-62
sp|Q9LF79|ACA8_ARATH Calcium-transporting ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=ACA8 PE=1 SV=1 234 1034 2.0E-62
sp|Q12691|ATN5_YEAST Sodium transport ATPase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA5 PE=1 SV=1 95 979 5.0E-62
sp|Q01896|ATN2_YEAST Sodium transport ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA2 PE=1 SV=1 95 979 8.0E-62
sp|P13587|ATN1_YEAST Sodium transport ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ENA1 PE=1 SV=1 95 979 5.0E-61
sp|Q2QY12|ACA4_ORYSJ Probable calcium-transporting ATPase 4, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os12g0136900 PE=3 SV=1 236 1097 4.0E-60
sp|P23634|AT2B4_HUMAN Plasma membrane calcium-transporting ATPase 4 OS=Homo sapiens GN=ATP2B4 PE=1 SV=2 77 1034 3.0E-59
sp|Q2RAS0|ACA5_ORYSJ Probable calcium-transporting ATPase 5, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os11g0140400 PE=3 SV=1 236 944 7.0E-59
sp|P0ABB8|ATMA_ECOLI Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli (strain K12) GN=mgtA PE=1 SV=1 215 1113 7.0E-59
sp|P0ABB9|ATMA_ECO57 Magnesium-transporting ATPase, P-type 1 OS=Escherichia coli O157:H7 GN=mgtA PE=3 SV=1 215 1113 7.0E-59
sp|P54678|ATC1_DICDI Calcium-transporting ATPase PAT1 OS=Dictyostelium discoideum GN=patA PE=2 SV=2 191 1071 2.0E-58
sp|Q64542|AT2B4_RAT Plasma membrane calcium-transporting ATPase 4 OS=Rattus norvegicus GN=Atp2b4 PE=1 SV=1 81 1034 2.0E-58
sp|Q9R0K7|AT2B2_MOUSE Plasma membrane calcium-transporting ATPase 2 OS=Mus musculus GN=Atp2b2 PE=1 SV=2 199 1034 2.0E-58
sp|Q65X71|ACA6_ORYSJ Probable calcium-transporting ATPase 6, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os05g0495600 PE=3 SV=1 60 944 2.0E-58
sp|P22036|ATMB_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtB PE=1 SV=3 108 1113 5.0E-57
sp|P36640|ATMA_SALTY Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=mgtA PE=2 SV=1 216 1113 1.0E-56
sp|D0ZTB2|ATMA_SALT1 Magnesium-transporting ATPase, P-type 1 OS=Salmonella typhimurium (strain 14028s / SGSC 2262) GN=mgtA PE=2 SV=1 216 1113 1.0E-56
sp|Q6Q477|AT2B4_MOUSE Plasma membrane calcium-transporting ATPase 4 OS=Mus musculus GN=Atp2b4 PE=1 SV=1 81 949 4.0E-56
sp|Q9SZR1|ACA10_ARATH Calcium-transporting ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=ACA10 PE=1 SV=2 236 954 3.0E-55
sp|Q8RUN1|ACA3_ORYSJ Calcium-transporting ATPase 3, plasma membrane-type OS=Oryza sativa subsp. japonica GN=Os01g0939100 PE=2 SV=1 57 944 3.0E-55
sp|Q9M2L4|ACA11_ARATH Putative calcium-transporting ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=ACA11 PE=1 SV=1 236 944 6.0E-55
sp|D3K0R6|AT2B4_BOVIN Plasma membrane calcium-transporting ATPase 4 OS=Bos taurus GN=ATP2B4 PE=1 SV=2 55 1034 4.0E-54
sp|O22218|ACA4_ARATH Calcium-transporting ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=ACA4 PE=1 SV=1 236 944 4.0E-54
sp|Q9HDW7|ATC2_SCHPO Calcium-transporting ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pmc1 PE=3 SV=1 123 1042 2.0E-53
sp|Q9LY77|ACA12_ARATH Calcium-transporting ATPase 12, plasma membrane-type OS=Arabidopsis thaliana GN=ACA12 PE=2 SV=1 101 944 1.0E-52
sp|P78036|ATCL_MYCPN Probable cation-transporting P-type ATPase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=pacL PE=3 SV=1 216 887 1.0E-52
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 566 1114 1.0E-50
sp|Q9SH76|PMA6_ARATH ATPase 6, plasma membrane-type OS=Arabidopsis thaliana GN=AHA6 PE=2 SV=1 84 1047 1.0E-50
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 338 1034 3.0E-48
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 338 1034 4.0E-48
sp|Q9LU41|ACA9_ARATH Calcium-transporting ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=ACA9 PE=2 SV=2 234 959 4.0E-48
sp|P19456|PMA2_ARATH ATPase 2, plasma membrane-type OS=Arabidopsis thaliana GN=AHA2 PE=1 SV=2 92 929 8.0E-48
sp|Q7XPY2|PMA1_ORYSJ Plasma membrane ATPase OS=Oryza sativa subsp. japonica GN=Os04g0656100 PE=2 SV=1 108 929 2.0E-46
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 342 1034 5.0E-46
sp|Q9M2A0|PMA8_ARATH ATPase 8, plasma membrane-type OS=Arabidopsis thaliana GN=AHA8 PE=3 SV=1 84 929 8.0E-46
sp|P20431|PMA3_ARATH ATPase 3, plasma membrane-type OS=Arabidopsis thaliana GN=AHA3 PE=1 SV=2 92 929 8.0E-46
sp|Q9LIK7|ACA13_ARATH Putative calcium-transporting ATPase 13, plasma membrane-type OS=Arabidopsis thaliana GN=ACA13 PE=3 SV=1 221 944 1.0E-45
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 336 1034 3.0E-45
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 338 1034 3.0E-45
sp|Q9LV11|PMA11_ARATH ATPase 11, plasma membrane-type OS=Arabidopsis thaliana GN=AHA11 PE=1 SV=1 88 1047 4.0E-45
sp|Q9SU58|PMA4_ARATH ATPase 4, plasma membrane-type OS=Arabidopsis thaliana GN=AHA4 PE=2 SV=2 88 1110 4.0E-45
sp|O53114|CTPI_MYCLE Probable cation-transporting ATPase I OS=Mycobacterium leprae (strain TN) GN=ctpI PE=3 SV=1 244 938 6.0E-45
sp|Q42556|PMA9_ARATH ATPase 9, plasma membrane-type OS=Arabidopsis thaliana GN=AHA9 PE=2 SV=2 113 929 2.0E-44
sp|P20649|PMA1_ARATH ATPase 1, plasma membrane-type OS=Arabidopsis thaliana GN=AHA1 PE=1 SV=3 92 929 2.0E-44
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 342 1034 2.0E-44
sp|Q43128|PMA10_ARATH ATPase 10, plasma membrane-type OS=Arabidopsis thaliana GN=AHA10 PE=2 SV=2 98 1072 3.0E-44
sp|Q58623|Y1226_METJA Putative cation-transporting ATPase MJ1226 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ1226 PE=3 SV=1 97 1036 5.0E-44
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 342 1034 1.0E-43
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 365 1034 2.0E-43
sp|Q08435|PMA1_NICPL Plasma membrane ATPase 1 OS=Nicotiana plumbaginifolia GN=PMA1 PE=2 SV=1 73 1044 3.0E-43
sp|P54679|PMA1_DICDI Probable plasma membrane ATPase OS=Dictyostelium discoideum GN=patB PE=2 SV=2 108 889 4.0E-43
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 342 1034 2.0E-42
sp|P83970|PMA1_WHEAT Plasma membrane ATPase OS=Triticum aestivum GN=ha1 PE=2 SV=1 108 1044 3.0E-42
sp|Q9SJB3|PMA5_ARATH ATPase 5, plasma membrane-type OS=Arabidopsis thaliana GN=AHA5 PE=3 SV=3 108 929 3.0E-42
sp|P22180|PMA1_SOLLC Plasma membrane ATPase 1 OS=Solanum lycopersicum GN=LHA1 PE=2 SV=1 84 1047 4.0E-42
sp|Q9LY32|PMA7_ARATH ATPase 7, plasma membrane-type OS=Arabidopsis thaliana GN=AHA7 PE=2 SV=1 77 885 7.0E-42
sp|Q08436|PMA3_NICPL Plasma membrane ATPase 3 OS=Nicotiana plumbaginifolia GN=PMA3 PE=1 SV=1 84 1047 1.0E-41
sp|P54211|PMA1_DUNBI Plasma membrane ATPase OS=Dunaliella bioculata GN=PMA1 PE=2 SV=1 92 925 3.0E-41
sp|P12522|ATXB_LEIDO Probable proton ATPase 1B OS=Leishmania donovani GN=H1B PE=2 SV=1 108 889 4.0E-41
sp|P11718|ATXA_LEIDO Probable proton ATPase 1A OS=Leishmania donovani GN=H1A PE=2 SV=2 108 889 6.0E-41
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 344 1034 6.0E-41
sp|P9WPS5|CTPI_MYCTU Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpI PE=1 SV=1 246 936 1.0E-40
sp|P9WPS4|CTPI_MYCTO Probable cation-transporting ATPase I OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpI PE=3 SV=1 246 936 3.0E-40
sp|P54210|PMA1_DUNAC Plasma membrane ATPase OS=Dunaliella acidophila GN=DHA1 PE=2 SV=1 73 940 7.0E-39
sp|Q27533|YH2M_CAEEL Probable cation-transporting ATPase W08D2.5 OS=Caenorhabditis elegans GN=W08D2.5 PE=3 SV=2 233 1103 2.0E-36
sp|Q12697|YPK9_YEAST Vacuolar cation-transporting ATPase YPK9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPK9 PE=1 SV=1 204 873 8.0E-34
sp|Q9CTG6|AT132_MOUSE Probable cation-transporting ATPase 13A2 OS=Mus musculus GN=Atp13a2 PE=2 SV=3 203 886 1.0E-33
sp|O14072|ATC4_SCHPO Manganese-transporting ATPase 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta4 PE=3 SV=1 218 851 1.0E-33
sp|Q5ZKB7|AT134_CHICK Probable cation-transporting ATPase 13A4 OS=Gallus gallus GN=ATP13A4 PE=2 SV=1 245 843 4.0E-33
sp|Q3TYU2|AT135_MOUSE Probable cation-transporting ATPase 13A5 OS=Mus musculus GN=Atp13a5 PE=2 SV=2 197 843 3.0E-32
sp|Q9NQ11|AT132_HUMAN Probable cation-transporting ATPase 13A2 OS=Homo sapiens GN=ATP13A2 PE=1 SV=2 203 886 7.0E-32
sp|P39986|ATC6_YEAST Manganese-transporting ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPF1 PE=1 SV=1 232 848 5.0E-31
sp|Q5XF89|AT133_MOUSE Probable cation-transporting ATPase 13A3 OS=Mus musculus GN=Atp13a3 PE=1 SV=1 197 844 7.0E-31
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 598 979 8.0E-31
sp|Q08853|ATC_PLAFK Calcium-transporting ATPase OS=Plasmodium falciparum (isolate K1 / Thailand) GN=ATP6 PE=3 SV=1 96 453 2.0E-30
sp|Q21286|YBF7_CAEEL Probable cation-transporting ATPase K07E3.7 OS=Caenorhabditis elegans GN=K07E3.7/K07E3.6 PE=3 SV=4 237 899 4.0E-29
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 105 464 8.0E-29
sp|Q5XF90|AT134_MOUSE Probable cation-transporting ATPase 13A4 OS=Mus musculus GN=Atp13a4 PE=2 SV=1 197 843 8.0E-29
sp|Q4VNC0|AT135_HUMAN Probable cation-transporting ATPase 13A5 OS=Homo sapiens GN=ATP13A5 PE=2 SV=1 237 843 1.0E-28
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 105 464 3.0E-28
sp|Q4VNC1|AT134_HUMAN Probable cation-transporting ATPase 13A4 OS=Homo sapiens GN=ATP13A4 PE=2 SV=3 239 843 2.0E-27
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 114 464 2.0E-27
sp|O74431|ATC9_SCHPO Probable cation-transporting ATPase C1672.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1672.11c PE=3 SV=1 220 846 4.0E-27
sp|Q9EPE9|AT131_MOUSE Manganese-transporting ATPase 13A1 OS=Mus musculus GN=Atp13a1 PE=1 SV=2 222 843 3.0E-26
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 105 464 6.0E-26
sp|Q9HD20|AT131_HUMAN Manganese-transporting ATPase 13A1 OS=Homo sapiens GN=ATP13A1 PE=1 SV=2 222 843 2.0E-25
sp|P23980|PMA2_SOLLC Plasma membrane ATPase 2 (Fragment) OS=Solanum lycopersicum GN=LHA2 PE=3 SV=1 363 929 2.0E-25
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 105 464 3.0E-24
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 99 464 2.0E-22
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 108 462 3.0E-22
sp|Q03194|PMA4_NICPL Plasma membrane ATPase 4 OS=Nicotiana plumbaginifolia GN=PMA4 PE=2 SV=1 599 929 4.0E-22
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 201 464 8.0E-22
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 105 464 8.0E-22
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 99 464 4.0E-21
sp|P38929|ATC2_YEAST Calcium-transporting ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMC1 PE=1 SV=1 115 462 2.0E-19
sp|Q95050|ATX9_TETTH Probable cation-transporting ATPase 9 OS=Tetrahymena thermophila GN=TPA9 PE=2 SV=1 223 846 2.0E-19
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 92 462 9.0E-19
sp|P19657|PMA2_YEAST Plasma membrane ATPase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA2 PE=1 SV=3 591 937 2.0E-18
sp|Q10309|YD56_SCHPO Putative phospholipid-transporting ATPase C6C3.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC6C3.06c PE=3 SV=1 247 903 2.0E-18
sp|P05030|PMA1_YEAST Plasma membrane ATPase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PMA1 PE=1 SV=2 591 986 3.0E-18
sp|P49380|PMA1_KLULA Plasma membrane ATPase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PMA1 PE=1 SV=1 591 929 6.0E-17
sp|O94296|YOOC_SCHPO Probable phospholipid-transporting ATPase C887.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC887.12 PE=3 SV=1 323 905 8.0E-17
sp|P28877|PMA1_CANAX Plasma membrane ATPase 1 OS=Candida albicans GN=PMA1 PE=1 SV=1 591 935 1.0E-16
sp|P90747|AT131_CAEEL Probable manganese-transporting ATPase catp-8 OS=Caenorhabditis elegans GN=catp-8 PE=3 SV=3 236 843 3.0E-16
sp|P40527|ATC7_YEAST Probable phospholipid-transporting ATPase NEO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NEO1 PE=1 SV=1 319 890 1.0E-15
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 221 465 3.0E-15
sp|Q9U280|TAT1_CAEEL Phospholipid-transporting ATPase tat-1 OS=Caenorhabditis elegans GN=tat-1 PE=3 SV=3 439 843 4.0E-15
sp|P24545|PMA1_ZYGRO Plasma membrane ATPase OS=Zygosaccharomyces rouxii PE=3 SV=1 591 929 5.0E-15
sp|O14022|CTA5_SCHPO Cation-transporting ATPase 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cta5 PE=3 SV=1 232 850 5.0E-15
sp|Q9CCL1|CTPC_MYCLE Probable cation-transporting P-type ATPase C OS=Mycobacterium leprae (strain TN) GN=ctpC PE=3 SV=1 681 858 5.0E-15
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 197 462 7.0E-15
sp|A0R3A7|CTPD_MYCS2 Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=ctpD PE=1 SV=1 202 467 1.0E-14
sp|Q9XIE6|ALA3_ARATH Phospholipid-transporting ATPase 3 OS=Arabidopsis thaliana GN=ALA3 PE=1 SV=2 185 896 1.0E-14
sp|Q9SH30|HMA5_ARATH Probable copper-transporting ATPase HMA5 OS=Arabidopsis thaliana GN=HMA5 PE=1 SV=2 799 936 2.0E-14
sp|F1Q4S1|ATP9B_DANRE Probable phospholipid-transporting ATPase IIB OS=Danio rerio GN=atp9b PE=3 SV=1 244 856 2.0E-14
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 797 904 3.0E-14
sp|O70228|ATP9A_MOUSE Probable phospholipid-transporting ATPase IIA OS=Mus musculus GN=Atp9a PE=1 SV=3 244 856 3.0E-14
sp|O75110|ATP9A_HUMAN Probable phospholipid-transporting ATPase IIA OS=Homo sapiens GN=ATP9A PE=1 SV=3 244 856 5.0E-14
sp|Q9KPZ7|COPA_VIBCH Copper-exporting P-type ATPase A OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=copA PE=3 SV=1 799 881 8.0E-14
sp|P57792|ALA12_ARATH Probable phospholipid-transporting ATPase 12 OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1 323 887 9.0E-14
sp|P09627|PMA1_SCHPO Plasma membrane ATPase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma1 PE=1 SV=1 682 935 1.0E-13
sp|P9WPT1|CTPE_MYCTU Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpE PE=1 SV=1 598 902 1.0E-13
sp|P0A505|CTPE_MYCBO Probable cation-transporting ATPase E OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpE PE=3 SV=1 598 902 1.0E-13
sp|P9WPT0|CTPE_MYCTO Probable cation-transporting ATPase E OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpE PE=3 SV=1 598 902 2.0E-13
sp|O30085|COPB_ARCFU Copper-exporting P-type ATPase B OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copB PE=1 SV=1 800 927 3.0E-13
sp|P9WPT3|CTPD_MYCTU Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpD PE=3 SV=1 202 458 3.0E-13
sp|P9WPT2|CTPD_MYCTO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpD PE=3 SV=1 202 458 3.0E-13
sp|P63686|CTPD_MYCBO Probable cobalt/nickel-exporting P-type ATPase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpD PE=3 SV=1 202 458 3.0E-13
sp|P39524|ATC3_YEAST Probable phospholipid-transporting ATPase DRS2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DRS2 PE=1 SV=2 322 854 3.0E-13
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 682 861 4.0E-13
sp|P07038|PMA1_NEUCR Plasma membrane ATPase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=pma-1 PE=1 SV=1 591 942 7.0E-13
sp|D4ABB8|ATP9B_RAT Probable phospholipid-transporting ATPase IIB OS=Rattus norvegicus GN=Atp9b PE=3 SV=1 175 856 8.0E-13
sp|Q09891|ATCX_SCHPO Putative phospholipid-transporting ATPase C24B11.12c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24B11.12c PE=3 SV=1 440 978 9.0E-13
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 797 909 1.0E-12
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 797 909 1.0E-12
sp|Q9SAF5|ALA11_ARATH Probable phospholipid-transporting ATPase 11 OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1 323 843 2.0E-12
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 140 467 2.0E-12
sp|A1A4J6|ATP9B_BOVIN Probable phospholipid-transporting ATPase IIB OS=Bos taurus GN=ATP9B PE=2 SV=1 244 856 3.0E-12
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 197 467 3.0E-12
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 799 881 3.0E-12
sp|Q9H7F0|AT133_HUMAN Probable cation-transporting ATPase 13A3 OS=Homo sapiens GN=ATP13A3 PE=1 SV=4 570 844 4.0E-12
sp|P98195|ATP9B_MOUSE Probable phospholipid-transporting ATPase IIB OS=Mus musculus GN=Atp9b PE=1 SV=4 175 856 4.0E-12
sp|Q9Y2G3|AT11B_HUMAN Probable phospholipid-transporting ATPase IF OS=Homo sapiens GN=ATP11B PE=1 SV=2 322 998 6.0E-12
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 196 463 6.0E-12
sp|P23220|AT2B1_PIG Plasma membrane calcium-transporting ATPase 1 OS=Sus scrofa GN=ATP2B1 PE=2 SV=1 103 340 7.0E-12
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 197 467 7.0E-12
sp|Q64446|ATP7B_MOUSE Copper-transporting ATPase 2 OS=Mus musculus GN=Atp7b PE=1 SV=2 799 861 7.0E-12
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 799 892 9.0E-12
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 200 462 1.0E-11
sp|Q8TF62|AT8B4_HUMAN Probable phospholipid-transporting ATPase IM OS=Homo sapiens GN=ATP8B4 PE=1 SV=3 439 896 1.0E-11
sp|Q9XT50|ATP7B_SHEEP Copper-transporting ATPase 2 OS=Ovis aries GN=ATP7B PE=2 SV=1 799 873 1.0E-11
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 215 465 1.0E-11
sp|P11505|AT2B1_RAT Plasma membrane calcium-transporting ATPase 1 OS=Rattus norvegicus GN=Atp2b1 PE=1 SV=2 103 340 2.0E-11
sp|G5E829|AT2B1_MOUSE Plasma membrane calcium-transporting ATPase 1 OS=Mus musculus GN=Atp2b1 PE=1 SV=1 103 340 2.0E-11
sp|P20020|AT2B1_HUMAN Plasma membrane calcium-transporting ATPase 1 OS=Homo sapiens GN=ATP2B1 PE=1 SV=3 103 340 2.0E-11
sp|P32113|COPA_ENTHA Probable copper-importing P-type ATPase A OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copA PE=1 SV=2 799 861 2.0E-11
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 805 887 2.0E-11
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 197 516 2.0E-11
sp|P28876|PMA2_SCHPO Plasma membrane ATPase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pma2 PE=3 SV=1 682 937 3.0E-11
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 797 899 3.0E-11
sp|B2TTJ7|KDPB_SHIB3 Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=kdpB PE=3 SV=1 800 871 3.0E-11
sp|Q71W90|KDPB_LISMF Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain F2365) GN=kdpB PE=3 SV=1 800 915 3.0E-11
sp|C1KZN5|KDPB_LISMC Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=kdpB PE=3 SV=1 800 915 3.0E-11
sp|B8DAW1|KDPB_LISMH Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=kdpB PE=3 SV=1 800 915 3.0E-11
sp|A0AM16|KDPB_LISW6 Potassium-transporting ATPase ATP-binding subunit OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=kdpB PE=3 SV=1 800 915 4.0E-11
sp|Q8Y3Z7|KDPB_LISMO Potassium-transporting ATPase ATP-binding subunit OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=kdpB PE=3 SV=1 800 915 4.0E-11
sp|Q927G0|KDPB1_LISIN Potassium-transporting ATPase ATP-binding subunit 1 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB1 PE=3 SV=1 800 915 4.0E-11
sp|P11506|AT2B2_RAT Plasma membrane calcium-transporting ATPase 2 OS=Rattus norvegicus GN=Atp2b2 PE=1 SV=2 199 340 5.0E-11
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 220 464 5.0E-11
sp|Q64430|ATP7A_MOUSE Copper-transporting ATPase 1 OS=Mus musculus GN=Atp7a PE=1 SV=3 799 873 5.0E-11
sp|Q04656|ATP7A_HUMAN Copper-transporting ATPase 1 OS=Homo sapiens GN=ATP7A PE=1 SV=3 799 873 6.0E-11
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 799 881 6.0E-11
sp|Q00804|AT2B1_RABIT Plasma membrane calcium-transporting ATPase 1 OS=Oryctolagus cuniculus GN=ATP2B1 PE=2 SV=2 103 340 7.0E-11
sp|Q64535|ATP7B_RAT Copper-transporting ATPase 2 OS=Rattus norvegicus GN=Atp7b PE=1 SV=1 799 861 7.0E-11
sp|Q59998|ATZN_SYNY3 Zinc-transporting ATPase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ziaA PE=1 SV=1 189 465 7.0E-11
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 796 881 8.0E-11
sp|P35670|ATP7B_HUMAN Copper-transporting ATPase 2 OS=Homo sapiens GN=ATP7B PE=1 SV=4 799 861 9.0E-11
sp|Q01814|AT2B2_HUMAN Plasma membrane calcium-transporting ATPase 2 OS=Homo sapiens GN=ATP2B2 PE=1 SV=2 199 340 1.0E-10
sp|P37279|ATCS_SYNE7 Probable copper-transporting ATPase PacS OS=Synechococcus elongatus (strain PCC 7942) GN=pacS PE=3 SV=2 219 464 1.0E-10
sp|P37617|ATZN_ECOLI Lead, cadmium, zinc and mercury-transporting ATPase OS=Escherichia coli (strain K12) GN=zntA PE=1 SV=1 182 463 1.0E-10
sp|Q926K7|KDPB2_LISIN Potassium-transporting ATPase ATP-binding subunit 2 OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=kdpB2 PE=3 SV=1 800 861 1.0E-10
sp|P70705|ATP7A_RAT Copper-transporting ATPase 1 OS=Rattus norvegicus GN=Atp7a PE=1 SV=1 799 873 1.0E-10
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 799 867 1.0E-10
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 799 867 1.0E-10
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 799 867 1.0E-10
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 799 867 1.0E-10
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 796 881 1.0E-10
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 799 867 1.0E-10
sp|Q9X5V3|ATCU_RHILV Copper-transporting P-type ATPase OS=Rhizobium leguminosarum bv. viciae GN=actP PE=1 SV=1 799 915 1.0E-10
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 800 871 1.0E-10
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 799 867 1.0E-10
sp|Q8KU73|KDPB_ENTFA Potassium-transporting ATPase ATP-binding subunit OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=kdpB PE=3 SV=1 800 873 1.0E-10
sp|P49015|ATP7A_CRIGR Copper-transporting ATPase 1 (Fragment) OS=Cricetulus griseus GN=ATP7A PE=2 SV=1 799 888 1.0E-10
sp|Q9RQB4|HMCT_HELFE Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter felis GN=cadA PE=3 SV=1 151 464 1.0E-10
sp|Q16720|AT2B3_HUMAN Plasma membrane calcium-transporting ATPase 3 OS=Homo sapiens GN=ATP2B3 PE=1 SV=3 86 340 2.0E-10
sp|B5XZE9|KDPB_KLEP3 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae (strain 342) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q8Z8E5|KDPB_SALTI Putative potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhi GN=kdpB PE=5 SV=1 800 871 2.0E-10
sp|A6T6D8|KDPB_KLEP7 Potassium-transporting ATPase ATP-binding subunit OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B7N9U0|KDPB_ECOLU Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B1IY32|KDPB_ECOLC Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 799 867 2.0E-10
sp|Q667S4|KDPB_YERPS Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B1LLE1|KDPB_ECOSM Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B7LKR7|KDPB_ESCF3 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B6HYQ5|KDPB_ECOSE Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain SE11) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|P03960|KDPB_ECOLI Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12) GN=kdpB PE=1 SV=3 800 871 2.0E-10
sp|A7ZXV8|KDPB_ECOHS Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O9:H4 (strain HS) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B1X6M8|KDPB_ECODH Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / DH10B) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|C4ZWH3|KDPB_ECOBW Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|A7ZJ80|KDPB_ECO24 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q3Z4A6|KDPB_SHISS Potassium-transporting ATPase ATP-binding subunit OS=Shigella sonnei (strain Ss046) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B5EZE3|KDPB_SALA4 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella agona (strain SL483) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B5R670|KDPB_SALG2 Potassium-transporting ATPase ATP-binding subunit OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B7NMQ0|KDPB_ECO7I Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B1JR96|KDPB_YERPY Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|A4TL06|KDPB_YERPP Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis (strain Pestoides F) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q1CKH2|KDPB_YERPN Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|A9R3X3|KDPB_YERPG Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Angola) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q8ZD97|KDPB_YERPE Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B2KA78|KDPB_YERPB Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q1C586|KDPB_YERPA Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|A7FFQ9|KDPB_YERP3 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B4TQ22|KDPB_SALSV Potassium-transporting ATPase ATP-binding subunit OS=Salmonella schwarzengrund (strain CVM19633) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B7M5L3|KDPB_ECO8A Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O8 (strain IAI1) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B5YQN9|KDPB_ECO5E Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q8X9F9|KDPB_ECO57 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O157:H7 GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B7LAA4|KDPB_ECO55 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain 55989 / EAEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B7MPK0|KDPB_ECO81 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O81 (strain ED1a) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q1REM0|KDPB_ECOUT Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli (strain UTI89 / UPEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|A1A8W1|KDPB_ECOK1 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O1:K1 / APEC GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B7MFW2|KDPB_ECO45 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B5BCA4|KDPB_SALPK Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain AKU_12601) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q5PCJ7|KDPB_SALPA Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B5FNE0|KDPB_SALDC Potassium-transporting ATPase ATP-binding subunit OS=Salmonella dublin (strain CT_02021853) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q8FJV4|KDPB_ECOL6 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q0TJY9|KDPB_ECOL5 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B7UKX6|KDPB_ECO27 Potassium-transporting ATPase ATP-binding subunit OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|A1JQS2|KDPB_YERE8 Potassium-transporting ATPase ATP-binding subunit OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B4TBA6|KDPB_SALHS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella heidelberg (strain SL476) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B5QWE9|KDPB_SALEP Potassium-transporting ATPase ATP-binding subunit OS=Salmonella enteritidis PT4 (strain P125109) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q57RN0|KDPB_SALCH Potassium-transporting ATPase ATP-binding subunit OS=Salmonella choleraesuis (strain SC-B67) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q8ZQW2|KDPB_SALTY Potassium-transporting ATPase ATP-binding subunit OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|A9MUE0|KDPB_SALPB Potassium-transporting ATPase ATP-binding subunit OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|B4SZB1|KDPB_SALNS Potassium-transporting ATPase ATP-binding subunit OS=Salmonella newport (strain SL254) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|C4LDL7|KDPB_TOLAT Potassium-transporting ATPase ATP-binding subunit OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=kdpB PE=3 SV=1 800 871 2.0E-10
sp|Q8ZCA7|COPA_YERPE Copper-exporting P-type ATPase A OS=Yersinia pestis GN=copA PE=3 SV=1 799 881 2.0E-10
sp|Q324L0|KDPB_SHIBS Potassium-transporting ATPase ATP-binding subunit OS=Shigella boydii serotype 4 (strain Sb227) GN=kdpB PE=3 SV=1 800 871 3.0E-10
sp|Q59385|COPA_ECOLI Copper-exporting P-type ATPase A OS=Escherichia coli (strain K12) GN=copA PE=1 SV=4 796 881 3.0E-10
sp|O32619|COPA_HELFC Copper-transporting ATPase OS=Helicobacter felis (strain ATCC 49179 / NCTC 12436 / CS1) GN=copA PE=3 SV=1 801 881 3.0E-10
sp|Q93MV5|KDPB_MYXXA Potassium-transporting ATPase ATP-binding subunit OS=Myxococcus xanthus GN=kdpB PE=3 SV=1 800 931 3.0E-10
sp|Q0TRT3|KDPB_CLOP1 Potassium-transporting ATPase ATP-binding subunit OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=kdpB PE=3 SV=1 800 940 3.0E-10
sp|B2VJK3|KDPB_ERWT9 Potassium-transporting ATPase ATP-binding subunit OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=kdpB PE=3 SV=1 800 918 3.0E-10
sp|Q64568|AT2B3_RAT Plasma membrane calcium-transporting ATPase 3 OS=Rattus norvegicus GN=Atp2b3 PE=1 SV=2 103 340 4.0E-10
sp|Q9GKS6|AT10D_MACFA Probable phospholipid-transporting ATPase VD (Fragment) OS=Macaca fascicularis GN=ATP10D PE=2 SV=1 631 887 4.0E-10
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 220 487 4.0E-10
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 220 487 4.0E-10
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 220 487 4.0E-10
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 220 487 4.0E-10
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 220 487 4.0E-10
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 800 871 4.0E-10
sp|A4W860|KDPB_ENT38 Potassium-transporting ATPase ATP-binding subunit OS=Enterobacter sp. (strain 638) GN=kdpB PE=3 SV=1 800 871 4.0E-10
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 219 467 5.0E-10
sp|Q9A7X7|KDPB_CAUCR Potassium-transporting ATPase ATP-binding subunit OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=kdpB PE=3 SV=1 800 940 5.0E-10
sp|Q8XD24|COPA_ECO57 Copper-exporting P-type ATPase A OS=Escherichia coli O157:H7 GN=copA PE=3 SV=3 796 881 5.0E-10
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 797 890 5.0E-10
sp|Q9N0Z4|AT11B_RABIT Probable phospholipid-transporting ATPase IF (Fragment) OS=Oryctolagus cuniculus GN=ATP11B PE=1 SV=2 439 981 5.0E-10
sp|Q4A0G1|COPA_STAS1 Copper-exporting P-type ATPase A OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=copA PE=3 SV=1 797 859 7.0E-10
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 220 487 7.0E-10
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 220 487 7.0E-10
sp|B2TMJ2|KDPB_CLOBB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=kdpB PE=3 SV=1 800 913 7.0E-10
sp|B2V2P3|KDPB_CLOBA Potassium-transporting ATPase ATP-binding subunit OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=kdpB PE=3 SV=1 800 913 7.0E-10
sp|A4SZG8|KDPB_POLSQ Potassium-transporting ATPase ATP-binding subunit OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=kdpB PE=3 SV=1 800 861 7.0E-10
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 220 487 7.0E-10
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 220 487 7.0E-10
sp|P98198|AT8B2_HUMAN Phospholipid-transporting ATPase ID OS=Homo sapiens GN=ATP8B2 PE=1 SV=2 591 906 7.0E-10
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 220 487 8.0E-10
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 220 487 8.0E-10
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 220 487 8.0E-10
sp|Q9LI83|ALA10_ARATH Phospholipid-transporting ATPase 10 OS=Arabidopsis thaliana GN=ALA10 PE=3 SV=1 323 843 8.0E-10
sp|P9WPU3|KDPB_MYCTU Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=kdpB PE=3 SV=1 800 913 9.0E-10
sp|P9WPU2|KDPB_MYCTO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=kdpB PE=3 SV=1 800 913 9.0E-10
sp|P63682|KDPB_MYCBO Potassium-transporting ATPase ATP-binding subunit OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=kdpB PE=3 SV=1 800 913 9.0E-10
sp|B4U8E4|KDPB_HYDS0 Potassium-transporting ATPase ATP-binding subunit OS=Hydrogenobaculum sp. (strain Y04AAS1) GN=kdpB PE=3 SV=1 800 869 1.0E-09
sp|P9WPT5|CTPC_MYCTU Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpC PE=1 SV=1 801 858 1.0E-09
sp|P9WPT4|CTPC_MYCTO Probable manganese/zinc-exporting P-type ATPase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpC PE=3 SV=1 801 858 1.0E-09
sp|P0A503|CTPC_MYCBO Probable cation-transporting P-type ATPase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpC PE=3 SV=1 801 858 1.0E-09
sp|O32219|CADA_BACSU Cadmium, zinc and cobalt-transporting ATPase OS=Bacillus subtilis (strain 168) GN=cadA PE=1 SV=1 205 464 1.0E-09
sp|P58165|AT2B2_OREMO Plasma membrane calcium-transporting ATPase 2 (Fragment) OS=Oreochromis mossambicus GN=atp2b2 PE=2 SV=1 215 340 2.0E-09
sp|Q47H39|KDPB_DECAR Potassium-transporting ATPase ATP-binding subunit OS=Dechloromonas aromatica (strain RCB) GN=kdpB PE=3 SV=1 800 940 2.0E-09
sp|Q8Z8S4|COPA_SALTI Copper-exporting P-type ATPase A OS=Salmonella typhi GN=copA PE=3 SV=3 796 881 2.0E-09
sp|Q8ZR95|COPA_SALTY Copper-exporting P-type ATPase A OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=copA PE=1 SV=3 796 881 2.0E-09
sp|P57698|KDPB_PSEAE Potassium-transporting ATPase ATP-binding subunit OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=kdpB PE=3 SV=1 799 909 2.0E-09
sp|Q8YSD5|KDPB2_NOSS1 Potassium-transporting ATPase ATP-binding subunit 2 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB2 PE=3 SV=1 800 861 2.0E-09
sp|P46840|CTPB_MYCLE Cation-transporting P-type ATPase B OS=Mycobacterium leprae (strain TN) GN=ctpB PE=3 SV=2 797 916 2.0E-09
sp|P59219|KDPB_LEPIN Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=kdpB PE=3 SV=2 800 873 2.0E-09
sp|Q72TM6|KDPB_LEPIC Potassium-transporting ATPase ATP-binding subunit OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=kdpB PE=3 SV=1 800 873 2.0E-09
sp|A8Z3F8|COPA_STAAT Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copA PE=3 SV=1 797 859 3.0E-09
sp|Q2FDV0|COPA_STAA3 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain USA300) GN=copA PE=3 SV=1 797 859 3.0E-09
sp|Q8NUQ9|COPA_STAAW Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MW2) GN=copA PE=3 SV=1 797 859 3.0E-09
sp|Q6G6B7|COPA_STAAS Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MSSA476) GN=copA PE=3 SV=1 797 859 3.0E-09
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 796 1013 3.0E-09
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 799 880 3.0E-09
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 220 464 3.0E-09
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 249 463 3.0E-09
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 797 859 3.0E-09
sp|Q8U9D9|KDPB_AGRFC Potassium-transporting ATPase ATP-binding subunit OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=kdpB PE=3 SV=2 800 861 3.0E-09
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|O32328|KDPB_CLOAB Potassium-transporting ATPase ATP-binding subunit OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=kdpB PE=3 SV=2 800 873 3.0E-09
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 796 869 3.0E-09
sp|Q7A3E6|COPA_STAAN Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain N315) GN=copA PE=1 SV=1 797 859 4.0E-09
sp|Q99R80|COPA_STAAM Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=copA PE=3 SV=1 797 859 4.0E-09
sp|A5IVY3|COPA_STAA9 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH9) GN=copA PE=3 SV=1 797 859 4.0E-09
sp|A6U4T8|COPA_STAA2 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain JH1) GN=copA PE=3 SV=1 797 859 4.0E-09
sp|A7X6S1|COPA_STAA1 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=copA PE=3 SV=1 797 859 4.0E-09
sp|A6QK47|COPA_STAAE Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain Newman) GN=copA PE=3 SV=1 797 859 4.0E-09
sp|Q5HCZ3|COPA_STAAC Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain COL) GN=copA PE=3 SV=1 797 859 4.0E-09
sp|Q2FV64|COPA_STAA8 Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain NCTC 8325) GN=copA PE=1 SV=1 797 859 4.0E-09
sp|Q4L970|COPA_STAHJ Copper-exporting P-type ATPase A OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copA PE=3 SV=1 799 859 4.0E-09
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 796 869 4.0E-09
sp|Q98GX6|KDPB_RHILO Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium loti (strain MAFF303099) GN=kdpB PE=3 SV=1 800 895 4.0E-09
sp|Q8R8I6|KDPB_CALS4 Potassium-transporting ATPase ATP-binding subunit OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=kdpB PE=3 SV=1 796 869 4.0E-09
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 220 487 5.0E-09
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 220 487 5.0E-09
sp|Q6GDP1|COPA_STAAR Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain MRSA252) GN=copA PE=3 SV=1 220 464 6.0E-09
sp|Q81HQ0|KDPB_BACCR Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=kdpB PE=3 SV=1 237 475 6.0E-09
sp|B7HDF9|KDPB_BACC4 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain B4264) GN=kdpB PE=3 SV=1 237 475 6.0E-09
sp|P98199|AT8B2_MOUSE Phospholipid-transporting ATPase ID OS=Mus musculus GN=Atp8b2 PE=2 SV=2 591 906 6.0E-09
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 783 881 6.0E-09
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 800 861 6.0E-09
sp|Q63FR0|KDPB_BACCZ Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain ZK / E33L) GN=kdpB PE=3 SV=1 237 475 7.0E-09
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 800 861 7.0E-09
sp|P73867|KDPB_SYNY3 Potassium-transporting ATPase ATP-binding subunit OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=kdpB PE=3 SV=1 800 861 7.0E-09
sp|P57699|KDPB_HALSA Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=kdpB PE=3 SV=1 801 869 7.0E-09
sp|B0R9M0|KDPB_HALS3 Potassium-transporting ATPase ATP-binding subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=kdpB PE=2 SV=1 801 869 7.0E-09
sp|Q07421|PMA1_AJECA Plasma membrane ATPase OS=Ajellomyces capsulatus GN=PMA1 PE=3 SV=1 682 929 8.0E-09
sp|Q8CQF7|COPB_STAES Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copB PE=3 SV=1 224 463 8.0E-09
sp|P9WPU1|CTPA_MYCTU Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpA PE=1 SV=1 796 880 8.0E-09
sp|P9WPU0|CTPA_MYCTO Cation-transporting P-type ATPase A OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpA PE=3 SV=1 796 880 8.0E-09
sp|P37385|ATSY_SYNE7 Probable copper-transporting ATPase SynA OS=Synechococcus elongatus (strain PCC 7942) GN=synA PE=3 SV=1 797 916 8.0E-09
sp|B7HWG1|KDPB_BACC7 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH187) GN=kdpB PE=3 SV=1 237 475 9.0E-09
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 800 861 9.0E-09
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 801 861 9.0E-09
sp|P07893|ATSY_SYNP6 Probable copper-transporting ATPase SynA OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=synA PE=3 SV=2 797 916 9.0E-09
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 801 861 9.0E-09
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 801 861 9.0E-09
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 801 861 9.0E-09
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 801 861 9.0E-09
sp|P73241|ATCS_SYNY3 Probable copper-transporting ATPase PacS OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=pacS PE=1 SV=1 220 464 1.0E-08
sp|Q4LAB1|COPB_STAHJ Probable copper-transporting P-type ATPase B OS=Staphylococcus haemolyticus (strain JCSC1435) GN=copB PE=3 SV=2 224 463 1.0E-08
sp|Q9RQB4|HMCT_HELFE Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter felis GN=cadA PE=3 SV=1 790 879 1.0E-08
sp|B7II09|KDPB_BACC2 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain G9842) GN=kdpB PE=3 SV=1 237 475 1.0E-08
sp|C3LF99|KDPB_BACAC Potassium-transporting ATPase ATP-binding subunit OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=kdpB PE=3 SV=1 237 475 1.0E-08
sp|C1EYK0|KDPB_BACC3 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain 03BB102) GN=kdpB PE=3 SV=1 237 475 1.0E-08
sp|A9VFM1|KDPB_BACWK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus weihenstephanensis (strain KBAB4) GN=kdpB PE=3 SV=1 237 475 1.0E-08
sp|Q8CN02|COPA_STAES Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 12228) GN=copA PE=3 SV=1 797 859 1.0E-08
sp|Q5HL56|COPA_STAEQ Copper-exporting P-type ATPase A OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copA PE=3 SV=1 797 859 1.0E-08
sp|Q95JN5|AT133_MACFA Probable cation-transporting ATPase 13A3 (Fragment) OS=Macaca fascicularis GN=ATP13A3 PE=2 SV=2 197 444 1.0E-08
sp|O29777|COPA_ARCFU Probable copper-exporting P-type ATPase A OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=copA PE=1 SV=1 215 464 2.0E-08
sp|O31688|ZOSA_BACSU Zinc-transporting ATPase OS=Bacillus subtilis (strain 168) GN=zosA PE=1 SV=1 201 459 2.0E-08
sp|Q9ZHC7|SILP_SALTM Silver exporting P-type ATPase OS=Salmonella typhimurium GN=silP PE=1 SV=1 807 860 2.0E-08
sp|P35597|EXP7_STRPN Probable cation-transporting ATPase exp7 OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=exp7 PE=3 SV=2 683 919 2.0E-08
sp|P58342|ATCU2_RHIME Copper-transporting ATPase 2 OS=Rhizobium meliloti (strain 1021) GN=actP2 PE=3 SV=1 220 464 2.0E-08
sp|A8YZ02|COPB_STAAT Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=copB PE=3 SV=1 224 463 2.0E-08
sp|Q2FKI2|COPB_STAA3 Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain USA300) GN=copB PE=3 SV=1 224 463 2.0E-08
sp|Q6GIX4|COPB_STAAR Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus (strain MRSA252) GN=copB PE=3 SV=1 224 463 2.0E-08
sp|Q5HKB0|COPB_STAEQ Probable copper-transporting P-type ATPase B OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=copB PE=3 SV=2 224 463 2.0E-08
sp|A0RA13|KDPB_BACAH Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis (strain Al Hakam) GN=kdpB PE=3 SV=1 237 475 2.0E-08
sp|Q6HN78|KDPB_BACHK Potassium-transporting ATPase ATP-binding subunit OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=kdpB PE=3 SV=1 237 475 2.0E-08
sp|B7JRB8|KDPB_BACC0 Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cereus (strain AH820) GN=kdpB PE=3 SV=1 237 475 2.0E-08
sp|Q4LAI2|KDPB_STAHJ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus haemolyticus (strain JCSC1435) GN=kdpB PE=3 SV=1 236 459 2.0E-08
sp|P46839|CTPA_MYCLE Cation-transporting P-type ATPase A OS=Mycobacterium leprae (strain TN) GN=ctpA PE=3 SV=2 796 866 2.0E-08
sp|P98204|ALA1_ARATH Phospholipid-transporting ATPase 1 OS=Arabidopsis thaliana GN=ALA1 PE=2 SV=1 637 885 2.0E-08
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 797 938 2.0E-08
sp|P55989|COPA_HELPY Copper-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=copA PE=3 SV=1 801 911 2.0E-08
sp|P77871|COPA1_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=2 801 911 2.0E-08
sp|Q9X8Z9|KDPB_STRCO Potassium-transporting ATPase ATP-binding subunit OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=kdpB PE=3 SV=3 800 861 2.0E-08
sp|Q9ZM69|COPA_HELPJ Copper-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=copA PE=3 SV=1 801 911 2.0E-08
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 800 861 2.0E-08
sp|Q59467|COPA2_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 801 911 2.0E-08
sp|Q69HU0|COPB_STAAU Probable copper-transporting P-type ATPase B OS=Staphylococcus aureus GN=copB PE=3 SV=1 224 463 3.0E-08
sp|Q2YWA3|COPA_STAAB Copper-exporting P-type ATPase A OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=copA PE=3 SV=1 797 859 3.0E-08
sp|Q92XJ0|KDPB_RHIME Potassium-transporting ATPase ATP-binding subunit OS=Rhizobium meliloti (strain 1021) GN=kdpB PE=3 SV=1 800 861 3.0E-08
sp|P9WPT9|CTPB_MYCTU Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpB PE=1 SV=1 805 880 3.0E-08
sp|P9WPT8|CTPB_MYCTO Cation-transporting P-type ATPase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpB PE=3 SV=1 805 880 3.0E-08
sp|P59947|CTPB_MYCBO Cation-transporting P-type ATPase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpB PE=3 SV=1 805 880 3.0E-08
sp|O54827|AT10A_MOUSE Probable phospholipid-transporting ATPase VA OS=Mus musculus GN=Atp10a PE=1 SV=4 635 887 3.0E-08
sp|O08462|COPA3_HELPX Copper-transporting ATPase OS=Helicobacter pylori GN=copA PE=3 SV=1 801 911 3.0E-08
sp|Q6GEZ7|KDPB2_STAAR Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB2 PE=3 SV=1 801 869 3.0E-08
sp|Q59465|HMCT_HELPY Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 201 478 3.0E-08
sp|P63684|KDPB2_STAAN Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain N315) GN=kdpB2 PE=3 SV=1 801 869 3.0E-08
sp|P63683|KDPB2_STAAM Potassium-transporting ATPase ATP-binding subunit 2 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB2 PE=3 SV=1 801 869 3.0E-08
sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 797 861 3.0E-08
sp|Q8NVI2|KDPB_STAAW Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MW2) GN=kdpB PE=3 SV=1 801 869 3.0E-08
sp|Q6G7N3|KDPB_STAAS Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain MSSA476) GN=kdpB PE=3 SV=1 801 869 3.0E-08
sp|A8Z4X9|KDPB_STAAT Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=kdpB PE=3 SV=1 801 869 3.0E-08
sp|A6QIS1|KDPB_STAAE Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain Newman) GN=kdpB PE=3 SV=1 801 869 3.0E-08
sp|Q5HEC4|KDPB_STAAC Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain COL) GN=kdpB PE=3 SV=1 801 869 3.0E-08
sp|P20021|CADA1_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 805 901 4.0E-08
sp|Q9SZW4|HMA2_ARATH Cadmium/zinc-transporting ATPase HMA2 OS=Arabidopsis thaliana GN=HMA2 PE=2 SV=1 199 482 4.0E-08
sp|Q2YUH7|KDPB_STAAB Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=kdpB PE=3 SV=1 801 869 4.0E-08
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 796 927 4.0E-08
sp|O60312|AT10A_HUMAN Probable phospholipid-transporting ATPase VA OS=Homo sapiens GN=ATP10A PE=2 SV=2 635 887 4.0E-08
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 591 978 4.0E-08
sp|P38995|ATU2_YEAST Copper-transporting ATPase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CCC2 PE=1 SV=1 797 859 5.0E-08
sp|Q97BF6|KDPB_THEVO Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=kdpB PE=3 SV=1 796 909 5.0E-08
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 226 464 6.0E-08
sp|O32220|COPA_BACSU Copper-exporting P-type ATPase A OS=Bacillus subtilis (strain 168) GN=copA PE=1 SV=2 215 465 7.0E-08
sp|Q12674|ATC8_YEAST Probable phospholipid-transporting ATPase DNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DNF3 PE=1 SV=1 635 844 7.0E-08
sp|Q6GIX1|CADA_STAAR Probable cadmium-transporting ATPase OS=Staphylococcus aureus (strain MRSA252) GN=cadA PE=3 SV=1 805 901 2.0E-07
sp|P37386|CADA2_STAAU Probable cadmium-transporting ATPase OS=Staphylococcus aureus GN=cadA PE=3 SV=1 805 901 2.0E-07
sp|O59666|ATU2_SCHPO Copper-transporting ATPase ccc2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ccc2 PE=3 SV=1 219 467 2.0E-07
sp|P58414|CADA_LISMO Probable cadmium-transporting ATPase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=cadA PE=3 SV=1 801 859 2.0E-07
sp|Q8PCM1|KDPB_XANCP Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=kdpB PE=3 SV=1 800 869 2.0E-07
sp|P77868|Y290_HAEIN Probable cation-transporting ATPase HI_0290 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0290 PE=3 SV=1 800 915 2.0E-07
sp|Q8PPC9|KDPB_XANAC Potassium-transporting ATPase ATP-binding subunit OS=Xanthomonas axonopodis pv. citri (strain 306) GN=kdpB PE=3 SV=1 800 869 2.0E-07
sp|Q9S7J8|HMA7_ARATH Copper-transporting ATPase RAN1 OS=Arabidopsis thaliana GN=RAN1 PE=1 SV=1 220 467 3.0E-07
sp|Q5HK64|KDPB_STAEQ Potassium-transporting ATPase ATP-binding subunit OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=kdpB PE=3 SV=1 236 459 3.0E-07
sp|Q6GKN3|KDPB1_STAAR Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain MRSA252) GN=kdpB1 PE=3 SV=1 236 459 3.0E-07
sp|P0A008|KDPB1_STAAN Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain N315) GN=kdpB1 PE=3 SV=1 236 459 3.0E-07
sp|P0A007|KDPB1_STAAM Potassium-transporting ATPase ATP-binding subunit 1 OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=kdpB1 PE=3 SV=1 236 459 3.0E-07
sp|Q9LK90|ALA8_ARATH Probable phospholipid-transporting ATPase 8 OS=Arabidopsis thaliana GN=ALA8 PE=3 SV=1 591 959 3.0E-07
sp|P30336|CADA_BACPE Probable cadmium-transporting ATPase OS=Bacillus pseudofirmus (strain OF4) GN=cadA PE=3 SV=2 801 859 4.0E-07
sp|P9WPT7|CTPJ_MYCTU Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpJ PE=2 SV=1 202 462 5.0E-07
sp|P9WPT6|CTPJ_MYCTO Probable cation-transporting P-type ATPase J OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpJ PE=3 SV=1 202 462 5.0E-07
sp|O36028|ATCZ_SCHPO Putative phospholipid-transporting ATPase C4F10.16c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC4F10.16c PE=3 SV=1 591 982 5.0E-07
sp|Q9X5X3|ATCU_SINMW Copper-transporting P-type ATPase OS=Sinorhizobium medicae (strain WSM419) GN=actP PE=1 SV=1 220 464 6.0E-07
sp|O33533|FIXI_RHILV Nitrogen fixation protein FixI OS=Rhizobium leguminosarum bv. viciae GN=fixI PE=3 SV=1 240 462 7.0E-07
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9 OS=Arabidopsis thaliana GN=ALA9 PE=3 SV=1 591 843 8.0E-07
sp|Q8YPE9|KDPB1_NOSS1 Potassium-transporting ATPase ATP-binding subunit 1 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=kdpB1 PE=3 SV=1 236 459 9.0E-07
sp|O64474|HMA4_ARATH Putative cadmium/zinc-transporting ATPase HMA4 OS=Arabidopsis thaliana GN=HMA4 PE=1 SV=2 173 464 1.0E-06
sp|Q9ZL53|HMCT_HELPJ Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 801 866 1.0E-06
sp|P18398|FIXI_RHIME Nitrogen fixation protein FixI OS=Rhizobium meliloti (strain 1021) GN=fixI PE=3 SV=1 240 465 1.0E-06
sp|P9WPS7|CTPG_MYCTU Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpG PE=1 SV=1 205 466 1.0E-06
sp|P9WPS6|CTPG_MYCTO Probable cation-transporting ATPase G OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpG PE=3 SV=1 205 466 1.0E-06
sp|P63690|CTPG_MYCBO Probable cation-transporting ATPase G OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ctpG PE=3 SV=1 205 466 1.0E-06
sp|Q9T0E0|PMAX_ARATH Putative ATPase, plasma membrane-like OS=Arabidopsis thaliana GN=At4g11730 PE=3 SV=1 806 885 2.0E-06
sp|P05425|COPB_ENTHA Copper-exporting P-type ATPase B OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258) GN=copB PE=1 SV=2 805 861 2.0E-06
sp|P58341|ATCU1_RHIME Copper-transporting ATPase 1 OS=Rhizobium meliloti (strain 1021) GN=actP1 PE=3 SV=1 220 464 2.0E-06
sp|Q9R6X1|KDPB_ANASL Potassium-transporting ATPase ATP-binding subunit OS=Anabaena sp. (strain L31) GN=kdpB PE=3 SV=1 240 459 2.0E-06
sp|Q59465|HMCT_HELPY Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=cadA PE=1 SV=2 801 866 2.0E-06
sp|P57700|KDPB_THEAC Potassium-transporting ATPase ATP-binding subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=kdpB PE=3 SV=1 198 459 2.0E-06
sp|P0CW77|HMA3A_ARATH Putative inactive cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=5 SV=1 140 464 2.0E-06
sp|Q04956|ATX1_PLAFA Probable cation-transporting ATPase 1 OS=Plasmodium falciparum PE=3 SV=1 322 462 2.0E-06
sp|Q60048|CADA_LISMN Probable cadmium-transporting ATPase OS=Listeria monocytogenes GN=cadA PE=1 SV=1 805 887 2.0E-06
sp|Q9ZL53|HMCT_HELPJ Cadmium, zinc and cobalt-transporting ATPase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=cadA PE=3 SV=1 189 478 3.0E-06
sp|Q7N6W6|KDPB_PHOLL Potassium-transporting ATPase ATP-binding subunit OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=kdpB PE=3 SV=1 238 459 5.0E-06
sp|A7GLG4|KDPB_BACCN Potassium-transporting ATPase ATP-binding subunit OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=kdpB PE=3 SV=1 237 477 5.0E-06
sp|Q9RZP0|KDPB_DEIRA Potassium-transporting ATPase ATP-binding subunit OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=kdpB PE=3 SV=1 240 459 5.0E-06
sp|P0CW78|HMA3B_ARATH Cadmium/zinc-transporting ATPase HMA3 OS=Arabidopsis thaliana GN=HMA3 PE=1 SV=1 140 464 5.0E-06
sp|P98196|AT11A_HUMAN Probable phospholipid-transporting ATPase IH OS=Homo sapiens GN=ATP11A PE=1 SV=3 650 998 5.0E-06
sp|P9WPS3|CTPV_MYCTU Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ctpV PE=1 SV=1 221 468 6.0E-06
sp|P9WPS2|CTPV_MYCTO Probable copper-exporting P-type ATPase V OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ctpV PE=3 SV=1 221 468 6.0E-06
sp|O60423|AT8B3_HUMAN Phospholipid-transporting ATPase IK OS=Homo sapiens GN=ATP8B3 PE=2 SV=4 791 979 6.0E-06
sp|A8GB61|KDPB_SERP5 Potassium-transporting ATPase ATP-binding subunit OS=Serratia proteamaculans (strain 568) GN=kdpB PE=3 SV=1 239 459 7.0E-06
sp|Q9LNQ4|ALA4_ARATH Probable phospholipid-transporting ATPase 4 OS=Arabidopsis thaliana GN=ALA4 PE=3 SV=2 591 887 8.0E-06
sp|Q8XU11|KDPB_RALSO Potassium-transporting ATPase ATP-binding subunit OS=Ralstonia solanacearum (strain GMI1000) GN=kdpB PE=3 SV=1 247 477 9.0E-06
sp|Q9SLK6|ALA6_ARATH Phospholipid-transporting ATPase 6 OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=2 323 488 9.0E-06
sp|Q9SZC9|HMA6_ARATH Copper-transporting ATPase PAA1, chloroplastic OS=Arabidopsis thaliana GN=PAA1 PE=2 SV=1 224 464 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 34 0.45

Transmembrane Domains

Domain # Start End Length
1 144 166 22
2 192 214 22
3 356 378 22
4 398 420 22
5 882 904 22
6 909 931 22
7 952 974 22
8 1014 1033 19
9 1054 1076 22
10 1081 1103 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6675
MTTDKAAADRIRWGDVEQGRSRSRHRSSRPLSRSNSVESLAIRSIHSRGQVDPALTLPIQYRTVSFQIEESKGKE
RVELARAADTAAKDLGDLEWHTLSADDVAQRLLTSPADGLSEEQGRRRLAEYGRNAPSPPKTNRLLAIFGYFFKG
FGGILLIGSVLVFVSWKPLGNPPALANLVITLSVPLMKLKLISRVQALAIVLLAVFFIQAGFAMFQDWSTSRVMA
SIKDMLPEHCQVTRDGQLVQLAAEDLVPGDVVSIKAGNKLPADVRFITMSSDAKFDRSVLTGESRPVAATVDHTD
DNYLETHNIGLQGTHCIVGSGIGIVVATGDRTVFGRIASLTNEPKSKMTTLEREVLYFVLFICAIMFAMIALVLI
LWGAWLRKDHPNWIDVPTLIVDCVSVAVAFIPEGLPIAITAGLTITANMMRKHKVLCKSLKTVETLGSVSVICSD
KTGTLTQGKMSLTDCSVGAANTTVQALHNDISQPKQPASLTPFLQLGALAALCNAAEMDVAQSDLPLDQRAVFGD
ATDTAILRFSESLADNNVGFYRSSWQRVFELAFNSKNKFMIRCFGLTRREALGSTLDHASADGFAEGDLLLTIKG
APDVLLGRCSHYVSPSGDLLPLDAEAAANLERIKDIYSSQGKRCLLLARKTVPAATVAAGPEPGTAKYEAAMMDE
ARTGLTLVGLVAIVDPLRPEIREVVSTLRGAGVRIAMVTGDFALTALAIAREAGIVTCLQVDTADNLDTRPRNPD
SGSASEDADEKKGGTTVVSGRGALVISGPELTRLSDGQWRLLTEYDEIVFARTTPEQKLRIVREFQHESVVAMTG
DGVNDAPSLKAADVGIALGSGSDIAMEAADMILLESFSSVVVAVQYGRVVFDNLKKVIAYLLPAGSFSEFWPVMT
SVIFGLPQILSSFLMIIICCFTDCAAATILSFEKPEADVLIRPPRNVKKDRLVNWQLILHAYGIVGMTETIASFA
MSFWYLQRNGIAFRDLWFSFGQLPPGIEKPYYDQKLAEASSIYFVNLVVMQWFNLMATRTRRLSIFQHPPMFNKE
TQNLYLFPSILFALGMALLWIYPSSIQSVLGTASIPVEYWFLPFSFGLFIILLDEARRYWVRRQPDSWVARAAW*
Coding >Ophun1|6675
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGCTGGGGCGACGTCGAGCAAGGCCGATCACGATCTCGTCAC
CGGTCATCGAGGCCGTTGAGCCGCTCCAACTCAGTCGAGTCGCTGGCCATCCGCAGCATCCATTCTCGCGGCCAG
GTCGATCCAGCATTGACACTACCCATCCAGTACCGGACCGTCTCCTTTCAAATCGAAGAATCCAAGGGCAAAGAA
CGCGTTGAACTCGCCCGCGCGGCTGACACGGCGGCCAAAGACCTTGGCGATCTCGAATGGCACACGCTTTCGGCT
GACGATGTCGCTCAGCGGCTGTTGACTTCGCCGGCGGATGGCCTCTCGGAGGAGCAGGGCCGGCGCAGACTGGCC
GAGTATGGACGGAACGCGCCGTCGCCGCCCAAGACGAACCGGCTGTTGGCCATCTTTGGATACTTCTTCAAGGGA
TTCGGTGGGATTCTTTTGATTGGCAGCGTCTTGGTGTTTGTATCGTGGAAGCCATTGGGAAACCCGCCGGCGCTG
GCCAACCTGGTGATTACCCTCTCTGTTCCCCTGATGAAGCTCAAGCTGATATCCAGAGTCCAGGCCCTCGCCATC
GTCCTCCTCGCCGTCTTCTTCATCCAGGCCGGCTTCGCCATGTTCCAAGACTGGTCTACCTCCCGCGTCATGGCC
TCGATCAAGGATATGCTCCCCGAACACTGCCAGGTGACTCGAGACGGCCAGCTCGTCCAACTCGCCGCCGAAGAC
CTCGTCCCCGGAGACGTCGTCTCCATCAAAGCCGGCAACAAGCTCCCCGCCGACGTCCGCTTCATCACCATGTCC
TCGGACGCAAAGTTCGACCGTTCCGTCTTGACTGGCGAGTCGCGGCCCGTGGCTGCTACCGTCGACCACACCGAC
GACAACTATCTCGAGACGCACAACATCGGCCTTCAGGGGACTCACTGCATCGTCGGTTCGGGCATCGGCATCGTC
GTCGCTACGGGAGATCGCACCGTCTTTGGGAGGATCGCGTCTCTGACCAACGAGCCCAAGAGTAAGATGACGACG
CTGGAACGAGAGGTGCTTTACTTTGTCCTCTTCATCTGCGCCATCATGTTTGCCATGATTGCCCTCGTCTTGATC
CTCTGGGGCGCCTGGCTTCGAAAAGATCATCCCAACTGGATCGATGTGCCGACGCTCATCGTCGATTGCGTCAGT
GTTGCCGTCGCTTTTATCCCCGAAGGTCTGCCCATTGCCATCACGGCTGGACTCACCATTACGGCCAACATGATG
CGGAAGCACAAGGTGCTGTGCAAGTCGCTCAAGACCGTTGAAACTCTGGGCTCCGTGTCCGTCATCTGCTCAGAC
AAGACGGGGACTCTTACCCAGGGCAAAATGTCCCTCACAGACTGCTCCGTCGGCGCCGCCAACACCACCGTCCAA
GCCCTCCACAACGACATCTCCCAACCCAAACAACCCGCCTCACTAACCCCCTTCCTCCAGCTCGGCGCCCTGGCC
GCCCTCTGCAACGCCGCCGAGATGGACGTCGCCCAGTCCGACCTCCCCCTCGACCAGCGAGCCGTCTTCGGCGAC
GCCACCGACACCGCCATCCTGCGCTTCTCCGAGTCCCTGGCTGACAACAACGTTGGCTTCTACCGCTCGAGCTGG
CAGCGCGTCTTTGAGCTGGCGTTTAACAGCAAGAATAAGTTTATGATTCGCTGCTTTGGGTTGACGCGGAGGGAG
GCTCTTGGCTCGACTTTGGATCATGCTTCGGCTGATGGCTTTGCCGAGGGAGACTTACTCTTGACCATCAAGGGC
GCTCCCGATGTCCTTCTCGGCCGCTGCTCTCACTACGTCTCCCCCTCGGGCGACCTCCTCCCTCTCGATGCCGAA
GCCGCCGCCAACCTGGAGCGCATCAAGGACATCTACTCCTCCCAGGGCAAGCGATGCCTGCTTCTAGCCCGTAAG
ACGGTCCCCGCTGCCACCGTGGCCGCCGGCCCGGAACCCGGAACGGCCAAGTACGAGGCGGCCATGATGGACGAG
GCCAGAACCGGCCTGACGCTTGTCGGACTGGTGGCCATTGTCGATCCTCTTCGGCCTGAGATCCGAGAGGTAGTC
TCTACACTACGGGGAGCAGGCGTGAGAATCGCCATGGTCACCGGCGACTTCGCCCTCACAGCCCTAGCCATCGCC
CGCGAAGCCGGCATCGTAACCTGCCTCCAAGTCGACACAGCCGACAATCTCGACACAAGGCCCCGAAACCCAGAC
TCAGGCTCCGCCTCGGAAGACGCAGACGAGAAGAAAGGCGGCACAACCGTCGTCAGCGGCCGCGGCGCCCTCGTC
ATCAGCGGCCCTGAACTCACCCGCCTCAGCGACGGCCAGTGGCGTCTCCTCACCGAGTACGATGAGATCGTCTTC
GCCCGGACCACGCCGGAGCAGAAGTTGCGCATCGTTCGCGAGTTTCAGCATGAGAGTGTTGTGGCTATGACGGGT
GATGGGGTTAATGACGCGCCTTCGCTCAAGGCTGCTGACGTGGGTATTGCCTTGGGCAGCGGATCTGATATCGCC
ATGGAGGCTGCGGATATGATTCTGCTCGAGTCGTTTTCCTCTGTTGTCGTGGCTGTCCAGTACGGCCGTGTCGTC
TTTGACAATCTCAAAAAGGTCATCGCCTATCTTCTACCCGCTGGCAGTTTCTCCGAGTTCTGGCCCGTCATGACA
TCCGTCATCTTTGGCCTTCCGCAGATTCTGTCCTCGTTTCTCATGATCATCATCTGCTGCTTCACCGACTGCGCC
GCCGCAACCATCCTCTCCTTCGAGAAGCCCGAAGCCGACGTCCTCATCCGCCCTCCCCGCAACGTCAAGAAGGAC
AGACTCGTCAACTGGCAGCTCATCCTGCACGCCTACGGCATCGTCGGCATGACCGAGACGATCGCCTCCTTCGCC
ATGTCCTTCTGGTACCTGCAGCGCAACGGCATCGCCTTCCGAGACCTGTGGTTCAGCTTCGGCCAGCTGCCGCCC
GGCATTGAGAAGCCCTACTACGATCAGAAGCTGGCTGAGGCGTCTTCCATCTACTTCGTCAACCTCGTCGTCATG
CAGTGGTTCAATCTCATGGCTACCCGCACCCGTCGCCTGTCCATCTTCCAGCATCCGCCCATGTTCAACAAGGAG
ACGCAGAACCTGTACCTCTTCCCGTCTATTCTGTTTGCCCTGGGCATGGCCCTGCTGTGGATCTACCCGTCTTCC
ATCCAGAGCGTCCTGGGAACGGCCAGCATTCCCGTCGAATACTGGTTCCTGCCCTTTAGCTTCGGTCTGTTCATC
ATCCTGCTGGACGAGGCGAGGAGATATTGGGTCCGGAGACAGCCCGACAGCTGGGTGGCGAGGGCTGCATGGTGA
Transcript >Ophun1|6675
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGCTGGGGCGACGTCGAGCAAGGCCGATCACGATCTCGTCAC
CGGTCATCGAGGCCGTTGAGCCGCTCCAACTCAGTCGAGTCGCTGGCCATCCGCAGCATCCATTCTCGCGGCCAG
GTCGATCCAGCATTGACACTACCCATCCAGTACCGGACCGTCTCCTTTCAAATCGAAGAATCCAAGGGCAAAGAA
CGCGTTGAACTCGCCCGCGCGGCTGACACGGCGGCCAAAGACCTTGGCGATCTCGAATGGCACACGCTTTCGGCT
GACGATGTCGCTCAGCGGCTGTTGACTTCGCCGGCGGATGGCCTCTCGGAGGAGCAGGGCCGGCGCAGACTGGCC
GAGTATGGACGGAACGCGCCGTCGCCGCCCAAGACGAACCGGCTGTTGGCCATCTTTGGATACTTCTTCAAGGGA
TTCGGTGGGATTCTTTTGATTGGCAGCGTCTTGGTGTTTGTATCGTGGAAGCCATTGGGAAACCCGCCGGCGCTG
GCCAACCTGGTGATTACCCTCTCTGTTCCCCTGATGAAGCTCAAGCTGATATCCAGAGTCCAGGCCCTCGCCATC
GTCCTCCTCGCCGTCTTCTTCATCCAGGCCGGCTTCGCCATGTTCCAAGACTGGTCTACCTCCCGCGTCATGGCC
TCGATCAAGGATATGCTCCCCGAACACTGCCAGGTGACTCGAGACGGCCAGCTCGTCCAACTCGCCGCCGAAGAC
CTCGTCCCCGGAGACGTCGTCTCCATCAAAGCCGGCAACAAGCTCCCCGCCGACGTCCGCTTCATCACCATGTCC
TCGGACGCAAAGTTCGACCGTTCCGTCTTGACTGGCGAGTCGCGGCCCGTGGCTGCTACCGTCGACCACACCGAC
GACAACTATCTCGAGACGCACAACATCGGCCTTCAGGGGACTCACTGCATCGTCGGTTCGGGCATCGGCATCGTC
GTCGCTACGGGAGATCGCACCGTCTTTGGGAGGATCGCGTCTCTGACCAACGAGCCCAAGAGTAAGATGACGACG
CTGGAACGAGAGGTGCTTTACTTTGTCCTCTTCATCTGCGCCATCATGTTTGCCATGATTGCCCTCGTCTTGATC
CTCTGGGGCGCCTGGCTTCGAAAAGATCATCCCAACTGGATCGATGTGCCGACGCTCATCGTCGATTGCGTCAGT
GTTGCCGTCGCTTTTATCCCCGAAGGTCTGCCCATTGCCATCACGGCTGGACTCACCATTACGGCCAACATGATG
CGGAAGCACAAGGTGCTGTGCAAGTCGCTCAAGACCGTTGAAACTCTGGGCTCCGTGTCCGTCATCTGCTCAGAC
AAGACGGGGACTCTTACCCAGGGCAAAATGTCCCTCACAGACTGCTCCGTCGGCGCCGCCAACACCACCGTCCAA
GCCCTCCACAACGACATCTCCCAACCCAAACAACCCGCCTCACTAACCCCCTTCCTCCAGCTCGGCGCCCTGGCC
GCCCTCTGCAACGCCGCCGAGATGGACGTCGCCCAGTCCGACCTCCCCCTCGACCAGCGAGCCGTCTTCGGCGAC
GCCACCGACACCGCCATCCTGCGCTTCTCCGAGTCCCTGGCTGACAACAACGTTGGCTTCTACCGCTCGAGCTGG
CAGCGCGTCTTTGAGCTGGCGTTTAACAGCAAGAATAAGTTTATGATTCGCTGCTTTGGGTTGACGCGGAGGGAG
GCTCTTGGCTCGACTTTGGATCATGCTTCGGCTGATGGCTTTGCCGAGGGAGACTTACTCTTGACCATCAAGGGC
GCTCCCGATGTCCTTCTCGGCCGCTGCTCTCACTACGTCTCCCCCTCGGGCGACCTCCTCCCTCTCGATGCCGAA
GCCGCCGCCAACCTGGAGCGCATCAAGGACATCTACTCCTCCCAGGGCAAGCGATGCCTGCTTCTAGCCCGTAAG
ACGGTCCCCGCTGCCACCGTGGCCGCCGGCCCGGAACCCGGAACGGCCAAGTACGAGGCGGCCATGATGGACGAG
GCCAGAACCGGCCTGACGCTTGTCGGACTGGTGGCCATTGTCGATCCTCTTCGGCCTGAGATCCGAGAGGTAGTC
TCTACACTACGGGGAGCAGGCGTGAGAATCGCCATGGTCACCGGCGACTTCGCCCTCACAGCCCTAGCCATCGCC
CGCGAAGCCGGCATCGTAACCTGCCTCCAAGTCGACACAGCCGACAATCTCGACACAAGGCCCCGAAACCCAGAC
TCAGGCTCCGCCTCGGAAGACGCAGACGAGAAGAAAGGCGGCACAACCGTCGTCAGCGGCCGCGGCGCCCTCGTC
ATCAGCGGCCCTGAACTCACCCGCCTCAGCGACGGCCAGTGGCGTCTCCTCACCGAGTACGATGAGATCGTCTTC
GCCCGGACCACGCCGGAGCAGAAGTTGCGCATCGTTCGCGAGTTTCAGCATGAGAGTGTTGTGGCTATGACGGGT
GATGGGGTTAATGACGCGCCTTCGCTCAAGGCTGCTGACGTGGGTATTGCCTTGGGCAGCGGATCTGATATCGCC
ATGGAGGCTGCGGATATGATTCTGCTCGAGTCGTTTTCCTCTGTTGTCGTGGCTGTCCAGTACGGCCGTGTCGTC
TTTGACAATCTCAAAAAGGTCATCGCCTATCTTCTACCCGCTGGCAGTTTCTCCGAGTTCTGGCCCGTCATGACA
TCCGTCATCTTTGGCCTTCCGCAGATTCTGTCCTCGTTTCTCATGATCATCATCTGCTGCTTCACCGACTGCGCC
GCCGCAACCATCCTCTCCTTCGAGAAGCCCGAAGCCGACGTCCTCATCCGCCCTCCCCGCAACGTCAAGAAGGAC
AGACTCGTCAACTGGCAGCTCATCCTGCACGCCTACGGCATCGTCGGCATGACCGAGACGATCGCCTCCTTCGCC
ATGTCCTTCTGGTACCTGCAGCGCAACGGCATCGCCTTCCGAGACCTGTGGTTCAGCTTCGGCCAGCTGCCGCCC
GGCATTGAGAAGCCCTACTACGATCAGAAGCTGGCTGAGGCGTCTTCCATCTACTTCGTCAACCTCGTCGTCATG
CAGTGGTTCAATCTCATGGCTACCCGCACCCGTCGCCTGTCCATCTTCCAGCATCCGCCCATGTTCAACAAGGAG
ACGCAGAACCTGTACCTCTTCCCGTCTATTCTGTTTGCCCTGGGCATGGCCCTGCTGTGGATCTACCCGTCTTCC
ATCCAGAGCGTCCTGGGAACGGCCAGCATTCCCGTCGAATACTGGTTCCTGCCCTTTAGCTTCGGTCTGTTCATC
ATCCTGCTGGACGAGGCGAGGAGATATTGGGTCCGGAGACAGCCCGACAGCTGGGTGGCGAGGGCTGCATGGTGA
Gene >Ophun1|6675
ATGACGACCGACAAGGCGGCAGCGGATCGGATCCGCTGGGGCGACGTCGAGCAAGGCCGATCACGATCTCGTCAC
CGGTCATCGAGGCCGTTGAGCCGCTCCAACTCAGTCGAGTCGCTGGCCATCCGCAGCATCCATTCTCGCGGCCAG
GTCGATCCAGCATTGACACTACCCATCCAGTACCGGACCGTGTAAGCCGTTGCGTACTTTGTCCAGAGAGAAAAC
CCAGTCTGATAGCCGCCACAGCTCCTTTCAAATCGAAGAATCCAAGGGCAAAGAACGCGTTGAACTCGCCCGCGC
GGCTGACACGGCGGCCAAAGACCTTGGCGATCTCGAATGGCACACGCTTTCGGCTGACGATGTCGCTCAGCGGCT
GTTGACTTCGCCGGCGGATGGCCTCTCGGAGGAGCAGGGCCGGCGCAGACTGGCCGAGTATGGACGGAACGCGCC
GTCGCCGCCCAAGACGAACCGGCTGTTGGCCATCTTTGGATACTTCTTCAAGGGATTCGGTGGGATTCTTTTGAT
TGGCAGCGTCTTGGTGTTTGTATCGTGGAAGCCATTGGGAAACCCGCCGGCGCTGGCCAACCTGGTGATTACCCT
CTCTGTTCCCCTGATGAAGCTCAAGCTGATATCCAGAGTCCAGGCCCTCGCCATCGTCCTCCTCGCCGTCTTCTT
CATCCAGGCCGGCTTCGCCATGTTCCAAGACTGGTCTACCTCCCGCGTCATGGCCTCGATCAAGGATATGCTCCC
CGAACACTGCCAGGTGACTCGAGACGGCCAGCTCGTCCAACTCGCCGCCGAAGACCTCGTCCCCGGAGACGTCGT
CTCCATCAAAGCCGGCAACAAGCTCCCCGCCGACGTCCGCTTCATCACCATGTCCTCGGACGCAAAGTTCGACCG
TTCCGTCTTGACTGGCGAGTCGCGGCCCGTGGCTGCTACCGTCGACCACACCGACGACAACTATCTCGAGACGCA
CAACATCGGCCTTCAGGGGACTCACTGCATCGTCGGTTCGGGCATCGGCATCGTCGTCGCTACGGGAGATCGCAC
CGTCTTTGGGAGGATCGCGTCTCTGACCAACGAGCCCAAGAGTAAGATGACGACGCTGGAACGAGAGGTGCTTTA
CTTTGTCCTCTTCATCTGCGCCATCATGTTTGCCATGATTGCCCTCGTCTTGATCCTCTGGGGCGCCTGGCTTCG
AAAAGATCATCCCAACTGGATCGATGTGCCGACGCTCATCGTCGATTGCGTCAGTGTTGCCGTCGCTTTTATCCC
CGAAGGTCTGCCCATTGCCATCACGGCTGGACTCACCATTACGGCCAACATGATGCGGAAGCACAAGGTGCTGTG
CAAGTCGCTCAAGACCGTTGAAACTCTGGGCTCCGTGTCCGTCATCTGCTCAGACAAGACGGGGACTCTTACCCA
GGTAAGCCCCTATTCCAGTGAAGCCATCACCATCAAACACACACACACTCTAACATTACCATCCAGGGCAAAATG
TCCCTCACAGACTGCTCCGTCGGCGCCGCCAACACCACCGTCCAAGCCCTCCACAACGACATCTCCCAACCCAAA
CAACCCGCCTCACTAACCCCCTTCCTCCAGCTCGGCGCCCTGGCCGCCCTCTGCAACGCCGCCGAGATGGACGTC
GCCCAGTCCGACCTCCCCCTCGACCAGCGAGCCGTCTTCGGCGACGCCACCGACACCGCCATCCTGCGCTTCTCC
GAGTCCCTGGCTGACAACAACGTTGGCTTCTACCGCTCGAGCTGGCAGCGCGTCTTTGAGCTGGCGTTTAACAGC
AAGAATAAGTTTATGATTCGCTGCTTTGGGTTGACGCGGAGGGAGGCTCTTGGCTCGACTTTGGATCATGCTTCG
GCTGATGGCTTTGCCGAGGGAGACTTGTAAGTGCTCTTCACAGGAAGACATCCACAACCTGTCTGACACATCCAC
CAGACTCTTGACCATCAAGGGCGCTCCCGATGTCCTTCTCGGCCGCTGCTCTCACTACGTCTCCCCCTCGGGCGA
CCTCCTCCCTCTCGATGCCGAAGCCGCCGCCAACCTGGAGCGCATCAAGGACATCTACTCCTCCCAGGGCAAGCG
ATGCCTGCTTCTAGCCCGTAAGACGGTCCCCGCTGCCACCGTGGCCGCCGGCCCGGAACCCGGAACGGCCAAGTA
CGAGGCGGCCATGATGGACGAGGCCAGAACCGGCCTGACGCTTGTCGGACTGGTGGCCATTGTCGATCCTCTTCG
GCCTGAGATCCGAGAGGTAGTCTCTACACTACGGGGAGCAGGCGTGAGAATCGCCATGGTAAGTCCATCATCTCT
TACGCCAACACAGAGAGATGTTCTAACAAACCCCGAAAGGTCACCGGCGACTTCGCCCTCACAGCCCTAGCCATC
GCCCGCGAAGCCGGCATCGTAACCTGCCTCCAAGTCGACACAGCCGACAATCTCGACACAAGGCCCCGAAACCCA
GACTCAGGCTCCGCCTCGGAAGACGCAGACGAGAAGAAAGGCGGCACAACCGTCGTCAGCGGCCGCGGCGCCCTC
GTCATCAGCGGCCCTGAACTCACCCGCCTCAGCGACGGCCAGTGGCGTCTCCTCACCGAGTACGATGAGATCGTC
TTCGCCCGGACCACGCCGGAGCAGAAGTTGCGCATCGTTCGCGAGTTTCAGCATGAGAGTGTTGTGGCTATGACG
GGTGATGGGGTTAATGACGCGCCTTCGCTCAAGGCTGCTGACGTGGGTATTGCCTTGGGCAGCGGATCTGATATC
GCCATGGAGGCTGCGGATATGATTCTGCTCGAGTCGTTTTCCTCTGTTGTCGTGGCTGTCCAGTACGGCCGTGTC
GTCTTTGACAATCTCAAAAAGGTTGGTTTTATACTTGCATCTCTGGGTTGTCTGTTGAGTGTCCGTGGCTCACTC
GGTATCAGGTCATCGCCTATCTTCTACCCGCTGGCAGTTTCTCCGAGTTCTGGCCCGTCATGACATCCGTCATCT
TTGGCCTTCCGCAGATTCTGTCCTCGTTTCTCATGATCATCATCTGGTACGTTGAAGCAGTCCTCACTCACTCAT
CACCCCTTTACCCCTTTACCACTCCACAACCCGAGTCTAACCGCATCAGCTGCTTCACCGACTGCGCCGCCGCAA
CCATCCTCTCCTTCGAGAAGCCCGAAGCCGACGTCCTCATCCGCCCTCCCCGCAACGTCAAGAAGGACAGACTCG
TCAACTGGCAGCTCATCCTGCACGCCTACGGCATCGTCGGCATGACCGAGACGATCGCCTCCTTCGCCATGTCCT
TCTGGTACCTGCAGCGCAACGGCATCGCCTTCCGAGACCTGTGGTTCAGCTTCGGCCAGCTGCCGCCCGGCATTG
AGAAGCCCTACTACGATCAGAAGCTGGCTGAGGCGTCTTCCATCTACTTCGTCAACCTCGTCGTCATGCAGTGGT
TCAATCTCATGGCTACCCGCACCCGTCGCCTGTCCATCTTCCAGCATCCGCCCATGTTCAACAAGGAGACGCAGA
ACCTGTACCTCTTCCCGTCTATTCTGTTTGCCCTGGGCATGGCCCTGCTGTGGATCTACCCGTCTTCCATCCAGA
GCGTCCTGGGAACGGCCAGCATTCCCGTCGAATACTGGTTCCTGCCCTTTAGCTTCGGTCTGTTCATCATCCTGC
TGGACGAGGCGAGGAGATATTGGGTCCGGAGACAGCCCGACAGCTGGGTGGCGAGGGCTGCATGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail