Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|667
Gene name
LocationContig_121:3904..5212
Strand+
Gene length (bp)1308
Transcript length (bp)1164
Coding sequence length (bp)1164
Protein length (aa) 388

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12697 Abhydrolase_6 Alpha/beta hydrolase family 1.5E-09 90 354

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.998294

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup870
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4213
Ophiocordyceps australis map64 (Brazil) OphauB2|208
Ophiocordyceps camponoti-floridani Ophcf2|07011
Ophiocordyceps camponoti-rufipedis Ophun1|667 (this protein)
Ophiocordyceps kimflemingae Ophio5|6686
Ophiocordyceps subramaniannii Hirsu2|4952
Ophiocordyceps subramaniannii Hirsu2|8371

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|667
MFAPFAILGLAVTAAARNCIDISVNVALRPQMVRFDIQPPTTEVGIVDLILDATVAIPVIQPTQTTQTKTYRLAA
TYCSPDSGPGKALQILTHGLGFDKAYWDWDAGPSNGGHRYSYVDHALSRGYATLSWDRVGFSGSSRGDPIDEIQL
FLELDALAALTNWVRRGGLPGGQHQSSKIVLVGHSFGSALTTMVASQYPGLADGIVLTGFSQVYNFLPTYILASD
FISVRSRPWLSSYPEGYVVSQSAVGVQTDYFGPHNFDPVIMYQATARRVPIALGELMTLAVLYGPSILQLTVEAN
VIDRDLPFCGGNCSSTAIINNMAPNILEAARPNFASASVFETNIVPRAGHALNLEFSASLTYDVILDFIDRNLPP
SYGSYPHEPRHW*
Coding >Ophun1|667
ATGTTTGCGCCCTTCGCTATCCTCGGCCTCGCCGTTACGGCTGCGGCGCGCAACTGCATCGACATTTCTGTCAAT
GTTGCGTTGCGTCCGCAAATGGTGCGGTTTGATATCCAACCGCCCACGACTGAAGTCGGTATCGTCGATCTCATT
CTCGATGCTACTGTCGCGATCCCCGTCATTCAGCCGACACAGACTACACAAACAAAGACATATCGACTAGCAGCA
ACCTACTGCTCCCCCGACTCAGGCCCAGGCAAAGCCCTGCAAATCCTCACCCACGGCCTGGGCTTCGACAAAGCC
TACTGGGACTGGGACGCCGGCCCGAGCAATGGCGGCCACAGATACAGCTACGTCGACCACGCCCTCTCCCGCGGC
TACGCAACCCTCTCTTGGGACCGCGTAGGCTTCAGCGGCTCTTCACGCGGCGACCCCATCGACGAGATCCAGCTG
TTCCTTGAGCTGGACGCCTTGGCTGCTCTGACGAACTGGGTGCGTCGCGGTGGTTTACCGGGTGGTCAGCATCAG
AGCAGCAAGATTGTTCTCGTCGGGCATAGCTTTGGGTCCGCTTTGACGACCATGGTTGCGTCGCAGTATCCTGGA
CTGGCGGATGGTATCGTCTTGACGGGCTTCAGCCAGGTCTACAACTTCCTGCCCACCTATATCCTCGCCTCCGAC
TTCATCTCTGTGAGGTCGAGACCCTGGCTGTCCAGCTATCCCGAAGGCTACGTTGTTTCTCAGTCGGCCGTCGGA
GTGCAGACCGATTACTTTGGTCCTCACAACTTTGACCCGGTCATCATGTATCAAGCCACGGCCAGACGAGTTCCC
ATCGCGTTGGGCGAGTTGATGACGTTGGCTGTCCTCTATGGTCCGTCTATTCTCCAGCTGACAGTCGAGGCAAAC
GTGATAGATCGAGACCTGCCGTTCTGCGGAGGAAACTGCTCCAGCACAGCAATCATCAACAACATGGCCCCCAAC
ATTCTCGAGGCTGCGCGCCCCAACTTTGCCTCTGCGAGCGTCTTCGAGACCAACATCGTGCCCCGAGCCGGCCAT
GCCCTCAATCTGGAATTCTCGGCGTCTCTCACGTACGATGTCATTCTCGACTTCATCGACAGGAACCTGCCGCCT
TCGTACGGCTCATATCCGCATGAGCCGCGACATTGGTGA
Transcript >Ophun1|667
ATGTTTGCGCCCTTCGCTATCCTCGGCCTCGCCGTTACGGCTGCGGCGCGCAACTGCATCGACATTTCTGTCAAT
GTTGCGTTGCGTCCGCAAATGGTGCGGTTTGATATCCAACCGCCCACGACTGAAGTCGGTATCGTCGATCTCATT
CTCGATGCTACTGTCGCGATCCCCGTCATTCAGCCGACACAGACTACACAAACAAAGACATATCGACTAGCAGCA
ACCTACTGCTCCCCCGACTCAGGCCCAGGCAAAGCCCTGCAAATCCTCACCCACGGCCTGGGCTTCGACAAAGCC
TACTGGGACTGGGACGCCGGCCCGAGCAATGGCGGCCACAGATACAGCTACGTCGACCACGCCCTCTCCCGCGGC
TACGCAACCCTCTCTTGGGACCGCGTAGGCTTCAGCGGCTCTTCACGCGGCGACCCCATCGACGAGATCCAGCTG
TTCCTTGAGCTGGACGCCTTGGCTGCTCTGACGAACTGGGTGCGTCGCGGTGGTTTACCGGGTGGTCAGCATCAG
AGCAGCAAGATTGTTCTCGTCGGGCATAGCTTTGGGTCCGCTTTGACGACCATGGTTGCGTCGCAGTATCCTGGA
CTGGCGGATGGTATCGTCTTGACGGGCTTCAGCCAGGTCTACAACTTCCTGCCCACCTATATCCTCGCCTCCGAC
TTCATCTCTGTGAGGTCGAGACCCTGGCTGTCCAGCTATCCCGAAGGCTACGTTGTTTCTCAGTCGGCCGTCGGA
GTGCAGACCGATTACTTTGGTCCTCACAACTTTGACCCGGTCATCATGTATCAAGCCACGGCCAGACGAGTTCCC
ATCGCGTTGGGCGAGTTGATGACGTTGGCTGTCCTCTATGGTCCGTCTATTCTCCAGCTGACAGTCGAGGCAAAC
GTGATAGATCGAGACCTGCCGTTCTGCGGAGGAAACTGCTCCAGCACAGCAATCATCAACAACATGGCCCCCAAC
ATTCTCGAGGCTGCGCGCCCCAACTTTGCCTCTGCGAGCGTCTTCGAGACCAACATCGTGCCCCGAGCCGGCCAT
GCCCTCAATCTGGAATTCTCGGCGTCTCTCACGTACGATGTCATTCTCGACTTCATCGACAGGAACCTGCCGCCT
TCGTACGGCTCATATCCGCATGAGCCGCGACATTGGTGA
Gene >Ophun1|667
ATGTTTGCGCCCTTCGCTATCCTCGGCCTCGCCGTTACGGCTGCGGCGCGCAACTGCATCGACATTTCTGTCAAT
GTTGCGTTGCGTCCGCAAATGGTGCGGTTTGATATCCAACCGCCCACGACTGAAGTCGGTATCGTCGATCTCATT
CTCGATGCTACTGTCGCGATCCCCGTCATTCAGCCGACACAGACTACACAAGTACGGACACTGCAACAAAAGAGG
CCGAATAAAACCGATGAACCTACTGACAGAGGGAACCCTCGCAGACAAAGACATATCGACTAGCAGCAACCTACT
GCTCCCCCGACTCAGGCCCAGGCAAAGCCCTGCAAATCCTCACCCACGGCCTGGGCTTCGACAAAGCCTACTGGG
ACTGGGACGCCGGCCCGAGCAATGGCGGCCACAGATACAGCTACGTCGACCACGCCCTCTCCCGCGGCTACGCAA
CCCTCTCTTGGGACCGCGTAGGCTTCAGCGGCTCTTCACGCGGCGACCCCATCGACGAGATCCAGCTGTTCCTTG
AGCTGGACGCCTTGGCTGCTCTGACGAACTGGGTGCGTCGCGGTGGTTTACCGGGTGGTCAGCATCAGAGCAGCA
AGATTGTTCTCGTCGGGCATAGCTTTGGGTCCGCTTTGACGACCATGGTTGCGTCGCAGTATCCTGGACTGGCGG
ATGGTATCGTCTTGACGGGCTTCAGCCAGGTCTACAACTTCCTGCCCACCTATATCCTCGCCTCCGACTTCATCT
CTGTGAGGTCGAGACCCTGGCTGTCCAGCTATCCCGAAGGCTACGTTGTTTCTCAGTCGGCCGTCGGAGTGCAGA
CCGATTACTTTGGTCCTCACAACTTTGACCCGGTCATCATGTATCAAGCCACGGCCAGACGAGTTCCCATCGCGT
TGGGCGAGTTGATGACGTTGGCGTACGTGGCAAGCACGAGCAACTTCACAGGGCCAGTCCTGATGATTACCGGAA
GCGAGTCTCACCTTTCTCTCCAGTGTCCTCTATGGTCCGTCTATTCTCCAGCTGACAGTCGAGGCAAACGTGATA
GATCGAGACCTGCCGTTCTGCGGAGGAAACTGCTCCAGCACAGCAATCATCAACAACATGGCCCCCAACATTCTC
GAGGCTGCGCGCCCCAACTTTGCCTCTGCGAGCGTCTTCGAGACCAACATCGTGCCCCGAGCCGGCCATGCCCTC
AATCTGGAATTCTCGGCGTCTCTCACGTACGATGTCATTCTCGACTTCATCGACAGGAACCTGCCGCCTTCGTAC
GGCTCATATCCGCATGAGCCGCGACATTGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail