Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6668
Gene name
LocationContig_75:1760..4049
Strand-
Gene length (bp)2289
Transcript length (bp)1233
Coding sequence length (bp)1233
Protein length (aa) 411

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00083 Sugar_tr Sugar (and other) transporter 1.3E-24 95 286
PF00083 Sugar_tr Sugar (and other) transporter 1.6E-15 294 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 114 403 2.0E-29
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 114 403 2.0E-29
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 114 403 2.0E-29
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 114 403 3.0E-29
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 114 403 2.0E-28
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q2U2Y9|QUTD_ASPOR Probable quinate permease OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=qutD PE=3 SV=1 114 403 2.0E-29
sp|B8NIM7|QUTD_ASPFN Probable quinate permease OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=qutD PE=3 SV=1 114 403 2.0E-29
sp|Q4U3U4|QAY_NEUTR Quinate permease OS=Neurospora terricola GN=qa-y PE=3 SV=1 114 403 2.0E-29
sp|A2QQV6|QUTD_ASPNC Probable quinate permease OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=qutD PE=3 SV=1 114 403 3.0E-29
sp|P11636|QAY_NEUCR Quinate permease OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=qa-y PE=3 SV=2 114 403 2.0E-28
sp|Q4U3U6|QAY_NEUAF Quinate permease OS=Neurospora africana GN=qa-y PE=3 SV=1 114 402 3.0E-27
sp|A1CPX0|QUTD_ASPCL Probable quinate permease OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=qutD PE=3 SV=1 114 403 1.0E-26
sp|Q0D135|QUTD_ASPTN Probable quinate permease OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=qutD PE=3 SV=1 114 403 4.0E-26
sp|P15325|QUTD_EMENI Quinate permease OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=qutD PE=1 SV=2 114 403 4.0E-26
sp|Q6MYX6|QUTD_ASPFU Probable quinate permease OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=qutD PE=3 SV=1 114 403 4.0E-26
sp|B0XQS8|QUTD_ASPFC Probable quinate permease OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=qutD PE=3 SV=1 114 403 1.0E-21
sp|A1D2R3|QUTD_NEOFI Probable quinate permease OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=qutD PE=3 SV=1 114 403 1.0E-21
sp|B0WC46|TRET1_CULQU Facilitated trehalose transporter Tret1 OS=Culex quinquefasciatus GN=Tret1 PE=3 SV=1 140 398 3.0E-21
sp|Q9FRL3|ERDL6_ARATH Sugar transporter ERD6-like 6 OS=Arabidopsis thaliana GN=At1g75220 PE=1 SV=1 125 402 3.0E-20
sp|Q7PIR5|TRET1_ANOGA Facilitated trehalose transporter Tret1 OS=Anopheles gambiae GN=Tret1 PE=1 SV=3 134 408 4.0E-20
sp|A5LGM7|TRET1_POLVA Facilitated trehalose transporter Tret1 OS=Polypedilum vanderplanki GN=Tret1 PE=1 SV=1 140 408 2.0E-19
sp|P0AEP1|GALP_ECOLI Galactose-proton symporter OS=Escherichia coli (strain K12) GN=galP PE=1 SV=1 144 398 3.0E-19
sp|P0AEP2|GALP_ECOL6 Galactose-proton symporter OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=galP PE=3 SV=1 144 398 3.0E-19
sp|Q8MKK4|TRE12_DROME Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila melanogaster GN=Tret1-2 PE=2 SV=1 140 398 4.0E-19
sp|P43427|GTR5_RAT Solute carrier family 2, facilitated glucose transporter member 5 OS=Rattus norvegicus GN=Slc2a5 PE=1 SV=1 116 402 7.0E-19
sp|Q93YP9|ERDL4_ARATH Sugar transporter ERD6-like 4 OS=Arabidopsis thaliana GN=At1g19450 PE=2 SV=1 125 402 2.0E-18
sp|B4P624|TRET1_DROYA Facilitated trehalose transporter Tret1 OS=Drosophila yakuba GN=Tret1 PE=3 SV=1 134 408 3.0E-18
sp|B3MG58|TRET1_DROAN Facilitated trehalose transporter Tret1 OS=Drosophila ananassae GN=Tret1 PE=3 SV=2 134 408 3.0E-18
sp|Q8WMN1|GTR5_SHEEP Solute carrier family 2, facilitated glucose transporter member 5 OS=Ovis aries GN=SLC2A5 PE=2 SV=1 116 402 4.0E-18
sp|Q07647|GTR3_RAT Solute carrier family 2, facilitated glucose transporter member 3 OS=Rattus norvegicus GN=Slc2a3 PE=1 SV=1 128 404 6.0E-18
sp|P87110|ITR2_SCHPO Myo-inositol transporter 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr2 PE=2 SV=1 125 403 8.0E-18
sp|Q17NV8|TRET1_AEDAE Facilitated trehalose transporter Tret1 OS=Aedes aegypti GN=Tret1 PE=3 SV=1 134 408 8.0E-18
sp|P39932|STL1_YEAST Sugar transporter STL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=STL1 PE=1 SV=2 133 402 1.0E-17
sp|Q291H8|TRET1_DROPS Facilitated trehalose transporter Tret1 OS=Drosophila pseudoobscura pseudoobscura GN=Tret1 PE=3 SV=3 134 408 2.0E-17
sp|B4GAP7|TRET1_DROPE Facilitated trehalose transporter Tret1 OS=Drosophila persimilis GN=Tret1 PE=3 SV=2 134 408 2.0E-17
sp|P58353|GTR5_BOVIN Solute carrier family 2, facilitated glucose transporter member 5 OS=Bos taurus GN=SLC2A5 PE=1 SV=2 116 402 2.0E-17
sp|Q6PXP3|GTR7_HUMAN Solute carrier family 2, facilitated glucose transporter member 7 OS=Homo sapiens GN=SLC2A7 PE=2 SV=2 127 402 2.0E-17
sp|B4QBN2|TRE11_DROSI Facilitated trehalose transporter Tret1-1 OS=Drosophila simulans GN=Tret1-1 PE=3 SV=2 134 408 3.0E-17
sp|B4HNS1|TRE12_DROSE Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila sechellia GN=Tret1-2 PE=3 SV=1 140 398 4.0E-17
sp|A4ZYQ5|GTR7_RAT Solute carrier family 2, facilitated glucose transporter member 7 OS=Rattus norvegicus GN=Slc2a7 PE=2 SV=1 127 402 5.0E-17
sp|P32037|GTR3_MOUSE Solute carrier family 2, facilitated glucose transporter member 3 OS=Mus musculus GN=Slc2a3 PE=1 SV=1 128 404 9.0E-17
sp|A9ZSY2|TRET1_APILI Facilitated trehalose transporter Tret1 OS=Apis mellifera ligustica GN=Tret1 PE=1 SV=1 134 408 1.0E-16
sp|P54854|HXT15_YEAST Hexose transporter HXT15 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT15 PE=1 SV=1 133 403 1.0E-16
sp|B4QBN3|TRE12_DROSI Facilitated trehalose transporter Tret1-2 homolog OS=Drosophila simulans GN=Tret1-2 PE=3 SV=1 140 398 2.0E-16
sp|P47185|HXT16_YEAST Hexose transporter HXT16 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT16 PE=3 SV=1 133 403 4.0E-16
sp|Q0WUU6|PLT4_ARATH Probable polyol transporter 4 OS=Arabidopsis thaliana GN=PLT4 PE=2 SV=1 126 409 6.0E-16
sp|Q8LPQ8|MSSP2_ARATH Monosaccharide-sensing protein 2 OS=Arabidopsis thaliana GN=MSSP2 PE=1 SV=2 161 402 6.0E-16
sp|P38695|HXT5_YEAST Probable glucose transporter HXT5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT5 PE=1 SV=1 133 403 6.0E-16
sp|B4KR05|TRET1_DROMO Facilitated trehalose transporter Tret1 OS=Drosophila mojavensis GN=Tret1 PE=3 SV=2 134 408 8.0E-16
sp|Q8VZ80|PLT5_ARATH Polyol transporter 5 OS=Arabidopsis thaliana GN=PLT5 PE=1 SV=2 120 404 8.0E-16
sp|P53387|KHT2_KLULC Hexose transporter 2 OS=Kluyveromyces lactis GN=KHT2 PE=3 SV=1 133 403 8.0E-16
sp|Q9WV38|GTR5_MOUSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Mus musculus GN=Slc2a5 PE=1 SV=2 116 402 9.0E-16
sp|Q9XSC2|GTR3_RABIT Solute carrier family 2, facilitated glucose transporter member 3 (Fragment) OS=Oryctolagus cuniculus GN=SLC2A3 PE=2 SV=1 134 404 1.0E-15
sp|P53631|HXT17_YEAST Hexose transporter HXT17 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT17 PE=3 SV=1 133 403 2.0E-15
sp|B4LPX5|TRET1_DROVI Facilitated trehalose transporter Tret1 OS=Drosophila virilis GN=Tret1 PE=3 SV=2 134 408 2.0E-15
sp|P39924|HXT13_YEAST Hexose transporter HXT13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT13 PE=1 SV=1 133 403 2.0E-15
sp|B3NSE1|TRET1_DROER Facilitated trehalose transporter Tret1 OS=Drosophila erecta GN=Tret1 PE=3 SV=1 134 408 2.0E-15
sp|O34718|IOLT_BACSU Major myo-inositol transporter IolT OS=Bacillus subtilis (strain 168) GN=iolT PE=2 SV=1 113 402 2.0E-15
sp|B4MYA4|TRET1_DROWI Facilitated trehalose transporter Tret1 OS=Drosophila willistoni GN=Tret1 PE=3 SV=1 134 408 3.0E-15
sp|B4HNS0|TRE11_DROSE Facilitated trehalose transporter Tret1-1 OS=Drosophila sechellia GN=Tret1-1 PE=3 SV=1 134 408 3.0E-15
sp|Q39228|STP4_ARATH Sugar transport protein 4 OS=Arabidopsis thaliana GN=STP4 PE=1 SV=1 126 398 3.0E-15
sp|P13181|GAL2_YEAST Galactose transporter OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GAL2 PE=1 SV=3 133 403 4.0E-15
sp|Q8VZR6|INT1_ARATH Inositol transporter 1 OS=Arabidopsis thaliana GN=INT1 PE=1 SV=1 126 401 4.0E-15
sp|P30606|ITR2_YEAST Myo-inositol transporter 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR2 PE=1 SV=2 122 403 4.0E-15
sp|B4J913|TRET1_DROGR Facilitated trehalose transporter Tret1 OS=Drosophila grimshawi GN=Tret1 PE=3 SV=1 134 408 5.0E-15
sp|Q90592|GTR2_CHICK Solute carrier family 2, facilitated glucose transporter member 2 OS=Gallus gallus GN=SLC2A2 PE=2 SV=1 148 402 5.0E-15
sp|A9ZSY3|TRET1_BOMMO Facilitated trehalose transporter Tret1 OS=Bombyx mori GN=Tret1 PE=1 SV=1 134 398 6.0E-15
sp|O74713|HGT1_CANAX High-affinity glucose transporter OS=Candida albicans GN=HGT1 PE=3 SV=1 133 403 1.0E-14
sp|Q9SX48|STP9_ARATH Sugar transport protein 9 OS=Arabidopsis thaliana GN=STP9 PE=1 SV=1 4 398 1.0E-14
sp|Q5R608|GTR3_PONAB Solute carrier family 2, facilitated glucose transporter member 3 OS=Pongo abelii GN=SLC2A3 PE=2 SV=1 121 404 2.0E-14
sp|Q92253|RCO3_NEUCR Probable glucose transporter rco-3 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-3 PE=3 SV=2 12 403 2.0E-14
sp|A1Z8N1|TRE11_DROME Facilitated trehalose transporter Tret1-1 OS=Drosophila melanogaster GN=Tret1-1 PE=1 SV=1 134 408 2.0E-14
sp|P11169|GTR3_HUMAN Solute carrier family 2, facilitated glucose transporter member 3 OS=Homo sapiens GN=SLC2A3 PE=1 SV=1 121 404 2.0E-14
sp|P58354|GTR8_BOVIN Solute carrier family 2, facilitated glucose transporter member 8 OS=Bos taurus GN=SLC2A8 PE=2 SV=2 134 404 2.0E-14
sp|P07921|LACP_KLULA Lactose permease OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=LAC12 PE=3 SV=1 116 409 3.0E-14
sp|Q921A2|MYCT_RAT Proton myo-inositol cotransporter OS=Rattus norvegicus GN=Slc2a13 PE=1 SV=2 121 344 3.0E-14
sp|Q9XIH7|PLT1_ARATH Putative polyol transporter 1 OS=Arabidopsis thaliana GN=PLT1 PE=3 SV=1 120 402 3.0E-14
sp|Q0WQ63|ERDL8_ARATH Sugar transporter ERD6-like 8 OS=Arabidopsis thaliana GN=At3g05150 PE=2 SV=1 145 398 3.0E-14
sp|P0C6A1|GTR7_MOUSE Solute carrier family 2, facilitated glucose transporter member 7 OS=Mus musculus GN=Slc2a7 PE=3 SV=1 127 392 3.0E-14
sp|Q8TDB8|GTR14_HUMAN Solute carrier family 2, facilitated glucose transporter member 14 OS=Homo sapiens GN=SLC2A14 PE=2 SV=1 148 404 3.0E-14
sp|Q96290|MSSP1_ARATH Monosaccharide-sensing protein 1 OS=Arabidopsis thaliana GN=MSSP1 PE=1 SV=2 215 402 4.0E-14
sp|P28568|GTR3_CHICK Solute carrier family 2, facilitated glucose transporter member 3 OS=Gallus gallus GN=SLC2A3 PE=2 SV=1 127 403 4.0E-14
sp|Q94AF9|EDL11_ARATH Sugar transporter ERD6-like 11 OS=Arabidopsis thaliana GN=At3g05165 PE=2 SV=2 124 398 5.0E-14
sp|Q9NY64|GTR8_HUMAN Solute carrier family 2, facilitated glucose transporter member 8 OS=Homo sapiens GN=SLC2A8 PE=1 SV=3 134 404 5.0E-14
sp|Q9LT15|STP10_ARATH Sugar transport protein 10 OS=Arabidopsis thaliana GN=STP10 PE=2 SV=1 121 398 9.0E-14
sp|Q9UGQ3|GTR6_HUMAN Solute carrier family 2, facilitated glucose transporter member 6 OS=Homo sapiens GN=SLC2A6 PE=1 SV=2 133 402 9.0E-14
sp|P93051|ERDL7_ARATH Sugar transporter ERD6-like 7 OS=Arabidopsis thaliana GN=At2g48020 PE=2 SV=2 125 398 9.0E-14
sp|O74969|GHT2_SCHPO High-affinity glucose transporter ght2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght2 PE=1 SV=1 20 402 1.0E-13
sp|C7GWV6|HXT4_YEAS2 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain JAY291) GN=HXT4 PE=3 SV=1 133 403 1.0E-13
sp|Q9FMX3|STP11_ARATH Sugar transport protein 11 OS=Arabidopsis thaliana GN=STP11 PE=1 SV=1 126 401 1.0E-13
sp|Q9XIH6|PLT2_ARATH Putative polyol transporter 2 OS=Arabidopsis thaliana GN=PLT2 PE=3 SV=1 120 402 2.0E-13
sp|P32467|HXT4_YEAST Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT4 PE=1 SV=1 133 403 2.0E-13
sp|A6ZT02|HXT4_YEAS7 Low-affinity glucose transporter HXT4 OS=Saccharomyces cerevisiae (strain YJM789) GN=HXT4 PE=3 SV=1 133 403 2.0E-13
sp|Q3UHK1|MYCT_MOUSE Proton myo-inositol cotransporter OS=Mus musculus GN=Slc2a13 PE=1 SV=2 121 344 2.0E-13
sp|P14246|GTR2_MOUSE Solute carrier family 2, facilitated glucose transporter member 2 OS=Mus musculus GN=Slc2a2 PE=1 SV=3 121 402 2.0E-13
sp|P10870|SNF3_YEAST High-affinity glucose transporter SNF3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SNF3 PE=1 SV=3 133 402 2.0E-13
sp|Q9JJZ1|GTR8_RAT Solute carrier family 2, facilitated glucose transporter member 8 OS=Rattus norvegicus GN=Slc2a8 PE=1 SV=1 134 404 3.0E-13
sp|P11168|GTR2_HUMAN Solute carrier family 2, facilitated glucose transporter member 2 OS=Homo sapiens GN=SLC2A2 PE=1 SV=1 144 403 3.0E-13
sp|P47842|GTR3_CANLF Solute carrier family 2, facilitated glucose transporter member 3 OS=Canis lupus familiaris GN=SLC2A3 PE=2 SV=1 127 404 3.0E-13
sp|Q9SD00|MSSP3_ARATH Monosaccharide-sensing protein 3 OS=Arabidopsis thaliana GN=MSSP3 PE=2 SV=1 206 402 4.0E-13
sp|Q12300|RGT2_YEAST High-affinity glucose transporter RGT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGT2 PE=1 SV=1 133 402 4.0E-13
sp|O74849|GHT6_SCHPO High-affinity fructose transporter ght6 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght6 PE=1 SV=1 20 402 5.0E-13
sp|P54723|YFIG_BACSU Putative metabolite transport protein YfiG OS=Bacillus subtilis (strain 168) GN=yfiG PE=3 SV=1 113 402 5.0E-13
sp|P0AE24|ARAE_ECOLI Arabinose-proton symporter OS=Escherichia coli (strain K12) GN=araE PE=1 SV=1 124 398 6.0E-13
sp|P0AE25|ARAE_ECO57 Arabinose-proton symporter OS=Escherichia coli O157:H7 GN=araE PE=3 SV=1 124 398 6.0E-13
sp|Q9JIF3|GTR8_MOUSE Solute carrier family 2, facilitated glucose transporter member 8 OS=Mus musculus GN=Slc2a8 PE=1 SV=2 134 404 6.0E-13
sp|P32465|HXT1_YEAST Low-affinity glucose transporter HXT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT1 PE=1 SV=1 133 402 6.0E-13
sp|Q93Z80|EDL10_ARATH Sugar transporter ERD6-like 10 OS=Arabidopsis thaliana GN=At3g05160 PE=2 SV=1 124 398 8.0E-13
sp|Q93Y91|STP5_ARATH Sugar transport protein 5 OS=Arabidopsis thaliana GN=STP5 PE=2 SV=1 122 403 9.0E-13
sp|P30605|ITR1_YEAST Myo-inositol transporter 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITR1 PE=1 SV=2 126 403 1.0E-12
sp|P12336|GTR2_RAT Solute carrier family 2, facilitated glucose transporter member 2 OS=Rattus norvegicus GN=Slc2a2 PE=2 SV=1 121 402 1.0E-12
sp|P96710|ARAE_BACSU Arabinose-proton symporter OS=Bacillus subtilis (strain 168) GN=araE PE=2 SV=2 122 401 1.0E-12
sp|Q94AZ2|STP13_ARATH Sugar transport protein 13 OS=Arabidopsis thaliana GN=STP13 PE=1 SV=2 125 400 1.0E-12
sp|Q8GXR2|PLT6_ARATH Probable polyol transporter 6 OS=Arabidopsis thaliana GN=PLT6 PE=2 SV=2 120 403 2.0E-12
sp|O04249|STP7_ARATH Sugar transport protein 7 OS=Arabidopsis thaliana GN=STP7 PE=2 SV=1 125 401 2.0E-12
sp|Q96QE2|MYCT_HUMAN Proton myo-inositol cotransporter OS=Homo sapiens GN=SLC2A13 PE=1 SV=3 122 343 2.0E-12
sp|P39004|HXT7_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT7 PE=1 SV=1 133 403 3.0E-12
sp|P39003|HXT6_YEAST High-affinity hexose transporter HXT6 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT6 PE=1 SV=2 133 403 3.0E-12
sp|Q9ZNS0|PLT3_ARATH Probable polyol transporter 3 OS=Arabidopsis thaliana GN=PLT3 PE=3 SV=1 126 402 3.0E-12
sp|P32466|HXT3_YEAST Low-affinity glucose transporter HXT3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT3 PE=1 SV=1 133 402 4.0E-12
sp|P45598|ARAE_KLEOX Arabinose-proton symporter OS=Klebsiella oxytoca GN=araE PE=3 SV=1 124 398 4.0E-12
sp|Q9NRM0|GTR9_HUMAN Solute carrier family 2, facilitated glucose transporter member 9 OS=Homo sapiens GN=SLC2A9 PE=1 SV=2 134 402 4.0E-12
sp|P18631|RAG1_KLULA Low-affinity glucose transporter OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RAG1 PE=1 SV=1 133 409 6.0E-12
sp|P43581|HXT10_YEAST Hexose transporter HXT10 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT10 PE=1 SV=1 133 403 6.0E-12
sp|Q41144|STC_RICCO Sugar carrier protein C OS=Ricinus communis GN=STC PE=2 SV=1 125 403 6.0E-12
sp|C0SPB2|YWTG_BACSU Putative metabolite transport protein YwtG OS=Bacillus subtilis (strain 168) GN=ywtG PE=3 SV=1 59 400 7.0E-12
sp|Q10286|ITR1_SCHPO Myo-inositol transporter 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=itr1 PE=3 SV=1 122 403 7.0E-12
sp|Q8L7R8|STP3_ARATH Sugar transport protein 3 OS=Arabidopsis thaliana GN=STP3 PE=2 SV=2 122 403 9.0E-12
sp|P43562|YFE0_YEAST Probable metabolite transport protein YFL040W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YFL040W PE=1 SV=1 112 403 1.0E-11
sp|P47843|GTR3_SHEEP Solute carrier family 2, facilitated glucose transporter member 3 OS=Ovis aries GN=SLC2A3 PE=2 SV=1 127 404 1.0E-11
sp|P58352|GTR3_BOVIN Solute carrier family 2, facilitated glucose transporter member 3 OS=Bos taurus GN=SLC2A3 PE=2 SV=1 127 404 1.0E-11
sp|P23585|HXT2_YEAST High-affinity glucose transporter HXT2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT2 PE=1 SV=1 133 402 2.0E-11
sp|Q8IRI6|GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster GN=Glut1 PE=2 SV=4 125 402 2.0E-11
sp|Q9P3U6|GHT1_SCHPO High-affinity glucose transporter ght1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght1 PE=1 SV=1 20 402 2.0E-11
sp|P94493|YNCC_BACSU Putative metabolite transport protein YncC OS=Bacillus subtilis (strain 168) GN=yncC PE=3 SV=2 117 402 2.0E-11
sp|P0AGF4|XYLE_ECOLI D-xylose-proton symporter OS=Escherichia coli (strain K12) GN=xylE PE=1 SV=1 125 409 3.0E-11
sp|P0AGF5|XYLE_ECO57 D-xylose-proton symporter OS=Escherichia coli O157:H7 GN=xylE PE=3 SV=1 125 409 3.0E-11
sp|Q8LBI9|EDL16_ARATH Sugar transporter ERD6-like 16 OS=Arabidopsis thaliana GN=At5g18840 PE=2 SV=2 135 409 3.0E-11
sp|Q8GXK5|EDL14_ARATH Sugar transporter ERD6-like 14 OS=Arabidopsis thaliana GN=At4g04750 PE=2 SV=2 133 408 3.0E-11
sp|P40886|HXT8_YEAST Hexose transporter HXT8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT8 PE=1 SV=1 133 401 3.0E-11
sp|P46896|GTR1_CHICK Solute carrier family 2, facilitated glucose transporter member 1 OS=Gallus gallus GN=SLC2A1 PE=2 SV=1 121 402 3.0E-11
sp|P79365|GTR1_SHEEP Solute carrier family 2, facilitated glucose transporter member 1 (Fragment) OS=Ovis aries GN=SLC2A1 PE=2 SV=1 127 402 3.0E-11
sp|P11166|GTR1_HUMAN Solute carrier family 2, facilitated glucose transporter member 1 OS=Homo sapiens GN=SLC2A1 PE=1 SV=2 121 402 4.0E-11
sp|P20303|GTR1_PIG Solute carrier family 2, facilitated glucose transporter member 1 OS=Sus scrofa GN=SLC2A1 PE=2 SV=2 127 402 4.0E-11
sp|P46333|CSBC_BACSU Probable metabolite transport protein CsbC OS=Bacillus subtilis (strain 168) GN=csbC PE=1 SV=3 4 398 4.0E-11
sp|P27674|GTR1_BOVIN Solute carrier family 2, facilitated glucose transporter member 1 OS=Bos taurus GN=SLC2A1 PE=1 SV=1 127 402 4.0E-11
sp|Q5RET7|GTR5_PONAB Solute carrier family 2, facilitated glucose transporter member 5 OS=Pongo abelii GN=SLC2A5 PE=2 SV=1 127 402 5.0E-11
sp|Q56ZZ7|PLST4_ARATH Plastidic glucose transporter 4 OS=Arabidopsis thaliana GN=At5g16150 PE=1 SV=2 89 398 5.0E-11
sp|P40885|HXT9_YEAST Hexose transporter HXT9 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT9 PE=1 SV=1 144 401 5.0E-11
sp|P15686|HUP1_PARKE H(+)/hexose cotransporter 1 OS=Parachlorella kessleri GN=HUP1 PE=2 SV=2 122 402 7.0E-11
sp|Q2V4B9|PLST3_ARATH Probable plastidic glucose transporter 3 OS=Arabidopsis thaliana GN=At1g79820 PE=2 SV=2 126 398 7.0E-11
sp|Q94CI7|EDL17_ARATH Sugar transporter ERD6-like 17 OS=Arabidopsis thaliana GN=SFP1 PE=2 SV=2 134 409 9.0E-11
sp|P17809|GTR1_MOUSE Solute carrier family 2, facilitated glucose transporter member 1 OS=Mus musculus GN=Slc2a1 PE=1 SV=4 127 402 1.0E-10
sp|Q10710|STA_RICCO Sugar carrier protein A OS=Ricinus communis GN=STA PE=2 SV=1 141 398 1.0E-10
sp|P54862|HXT11_YEAST Hexose transporter HXT11 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT11 PE=1 SV=1 144 401 1.0E-10
sp|P11167|GTR1_RAT Solute carrier family 2, facilitated glucose transporter member 1 OS=Rattus norvegicus GN=Slc2a1 PE=1 SV=1 127 402 1.0E-10
sp|Q9SCW7|ERDL1_ARATH Sugar transporter ERD6-like 1 OS=Arabidopsis thaliana GN=SUGTL4 PE=2 SV=2 124 400 1.0E-10
sp|Q863Y9|GTR5_HORSE Solute carrier family 2, facilitated glucose transporter member 5 OS=Equus caballus GN=SLC2A5 PE=2 SV=1 148 402 1.0E-10
sp|O44827|FGT1_CAEEL Facilitated glucose transporter protein 1 OS=Caenorhabditis elegans GN=fgt-1 PE=1 SV=2 123 403 2.0E-10
sp|Q9M0Z9|EDL15_ARATH Sugar transporter ERD6-like 15 OS=Arabidopsis thaliana GN=At4g04760 PE=3 SV=2 134 402 3.0E-10
sp|P40441|HXT12_YEAST Putative hexose transporter 12 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT12 PE=5 SV=1 144 401 3.0E-10
sp|P58351|GTR2_BOVIN Solute carrier family 2, facilitated glucose transporter member 2 OS=Bos taurus GN=SLC2A2 PE=2 SV=2 126 317 3.0E-10
sp|P42833|HXT14_YEAST Hexose transporter HXT14 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HXT14 PE=1 SV=2 134 403 4.0E-10
sp|Q01440|GTR1_LEIDO Membrane transporter D1 OS=Leishmania donovani PE=3 SV=1 144 402 4.0E-10
sp|Q9BYW1|GTR11_HUMAN Solute carrier family 2, facilitated glucose transporter member 11 OS=Homo sapiens GN=SLC2A11 PE=2 SV=1 127 400 4.0E-10
sp|Q5RB09|GTR9_PONAB Solute carrier family 2, facilitated glucose transporter member 9 OS=Pongo abelii GN=SLC2A9 PE=2 SV=1 134 402 6.0E-10
sp|Q9P3U7|GHT8_SCHPO Probable high-affinity hexose transporter ght8, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght8 PE=1 SV=1 145 402 7.0E-10
sp|O65413|STP12_ARATH Sugar transport protein 12 OS=Arabidopsis thaliana GN=STP12 PE=2 SV=1 125 398 7.0E-10
sp|P78831|GHT5_SCHPO High-affinity glucose transporter ght5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght5 PE=1 SV=2 145 402 1.0E-09
sp|Q9SFG0|STP6_ARATH Sugar transport protein 6 OS=Arabidopsis thaliana GN=STP6 PE=1 SV=1 125 400 1.0E-09
sp|P13355|GTR1_RABIT Solute carrier family 2, facilitated glucose transporter member 1 OS=Oryctolagus cuniculus GN=SLC2A1 PE=2 SV=1 127 402 1.0E-09
sp|Q94CI6|EDL18_ARATH Sugar transporter ERD6-like 18 OS=Arabidopsis thaliana GN=SFP2 PE=2 SV=1 124 405 1.0E-09
sp|Q39524|HUP2_PARKE H(+)/hexose cotransporter 2 OS=Parachlorella kessleri GN=HUP2 PE=2 SV=1 125 402 2.0E-09
sp|Q6AWX0|XYLL2_ARATH D-xylose-proton symporter-like 2 OS=Arabidopsis thaliana GN=At5g17010 PE=1 SV=1 146 398 2.0E-09
sp|Q07423|HEX6_RICCO Hexose carrier protein HEX6 OS=Ricinus communis GN=HEX6 PE=2 SV=1 125 398 2.0E-09
sp|Q39525|HUP3_PARKE H(+)/hexose cotransporter 3 OS=Parachlorella kessleri GN=HUP3 PE=2 SV=1 125 402 3.0E-09
sp|Q8TFG1|GHT7_SCHPO Probable high-affinity hexose transporter ght7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght7 PE=3 SV=1 121 402 3.0E-09
sp|Q4F7G0|ERDL2_ARATH Sugar transporter ERD6-like 2 OS=Arabidopsis thaliana GN=SUGTL3 PE=2 SV=1 124 398 6.0E-09
sp|Q94KE0|ERDL3_ARATH Sugar transporter ERD6-like 3 OS=Arabidopsis thaliana GN=SUGTL2 PE=2 SV=1 134 398 9.0E-09
sp|P38142|YB91_YEAST Probable metabolite transport protein YBR241C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YBR241C PE=1 SV=1 144 357 1.0E-08
sp|Q9FYG3|PLST2_ARATH Probable plastidic glucose transporter 2 OS=Arabidopsis thaliana GN=At1g67300 PE=2 SV=1 134 398 2.0E-08
sp|P22732|GTR5_HUMAN Solute carrier family 2, facilitated glucose transporter member 5 OS=Homo sapiens GN=SLC2A5 PE=1 SV=1 148 402 2.0E-08
sp|Q9SBA7|STP8_ARATH Sugar transport protein 8 OS=Arabidopsis thaliana GN=STP8 PE=2 SV=2 126 400 2.0E-08
sp|Q27994|GTR4_BOVIN Solute carrier family 2, facilitated glucose transporter member 4 OS=Bos taurus GN=SLC2A4 PE=2 SV=2 127 284 3.0E-08
sp|P21906|GLF_ZYMMO Glucose facilitated diffusion protein OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=glf PE=3 SV=2 148 401 1.0E-07
sp|P19357|GTR4_RAT Solute carrier family 2, facilitated glucose transporter member 4 OS=Rattus norvegicus GN=Slc2a4 PE=1 SV=1 145 352 1.0E-07
sp|Q8VZT3|EDL12_ARATH Sugar transporter ERD6-like 12 OS=Arabidopsis thaliana GN=SUGTL5 PE=2 SV=1 124 398 2.0E-07
sp|O59932|GHT4_SCHPO High-affinity hexose transporter ght4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ght4 PE=3 SV=2 140 403 2.0E-07
sp|Q9ZQP6|INT3_ARATH Probable inositol transporter 3 OS=Arabidopsis thaliana GN=INT3 PE=2 SV=1 284 404 2.0E-07
sp|Q9LTP6|EDL13_ARATH Putative sugar transporter ERD6-like 13 OS=Arabidopsis thaliana GN=At3g20460 PE=3 SV=2 131 398 2.0E-07
sp|Q9C757|INT2_ARATH Probable inositol transporter 2 OS=Arabidopsis thaliana GN=INT2 PE=1 SV=1 308 403 5.0E-07
sp|P14142|GTR4_MOUSE Solute carrier family 2, facilitated glucose transporter member 4 OS=Mus musculus GN=Slc2a4 PE=1 SV=3 145 284 1.0E-06
sp|P14672|GTR4_HUMAN Solute carrier family 2, facilitated glucose transporter member 4 OS=Homo sapiens GN=SLC2A4 PE=1 SV=1 145 284 2.0E-06
sp|Q0WVE9|PLST1_ARATH Probable plastidic glucose transporter 1 OS=Arabidopsis thaliana GN=At1g05030 PE=2 SV=2 126 398 2.0E-06
sp|O23492|INT4_ARATH Inositol transporter 4 OS=Arabidopsis thaliana GN=INT4 PE=1 SV=1 284 403 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0022857 transmembrane transporter activity Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0051179 localization No
GO:0005215 transporter activity No
GO:0051234 establishment of localization No
GO:0003674 molecular_function No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0006810 transport No
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0008150 biological_process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 59 78 19
2 93 115 22
3 127 146 19
4 227 249 22
5 256 278 22
6 303 325 22
7 338 360 22
8 365 387 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup947
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1455
Ophiocordyceps australis map64 (Brazil) OphauB2|7871
Ophiocordyceps camponoti-floridani Ophcf2|01051
Ophiocordyceps camponoti-floridani Ophcf2|01052
Ophiocordyceps camponoti-rufipedis Ophun1|6668 (this protein)
Ophiocordyceps kimflemingae Ophio5|6815
Ophiocordyceps subramaniannii Hirsu2|6961

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6668
MGWYFVFTVGVIACGSIPKGYDEGGFAAASSLESFMSDFQLTTGRWNGTASQLASRRAVVTSLGVLGAAAGAGAA
VALTDRVGRLRAWQAFVAVWMTGFLAATMASGRLGLLLVARTMPPSRSQYRLVLAVPQIPVGLALVSSLFLDDTP
RWLAASRGADAALTALARLRGRSEVDAAVVSEWGEMRRRLADEEKHRAESTWAVVREVLSVGSYRRRFLLGLVVQ
TVAQWSGGNAITYYIADIFRLAGVATRRHSLLTAGSYGATKLVFTVVFAWGLIDYLGRRRFWRGSSNGHNESASH
AAVASVFVYAVGWSVGLCTVQYLYGTEILPTRVRGVCYAVNMAAHWLFQFAVVAVMPAMLARLDVWGAFVFWAAV
CAVGLVVLGLWAPETKGVAMEDMAELFEGPCSRRF*
Coding >Ophun1|6668
ATGGGCTGGTACTTTGTGTTTACCGTCGGGGTGATTGCCTGCGGGTCTATTCCGAAGGGCTACGATGAGGGAGGC
TTCGCCGCCGCCTCCAGCCTCGAATCCTTCATGTCCGACTTCCAGCTCACAACAGGCCGCTGGAACGGCACAGCC
TCGCAGCTAGCCTCTCGGCGAGCCGTCGTCACCTCTCTGGGGGTGCTGGGCGCGGCGGCGGGCGCGGGAGCGGCG
GTGGCGCTGACGGACCGCGTGGGGAGGCTCCGGGCGTGGCAGGCGTTTGTGGCCGTCTGGATGACGGGCTTCCTG
GCGGCTACCATGGCTTCTGGGAGGCTTGGGCTGCTGCTGGTTGCTAGGACCATGCCCCCCTCCCGCTCGCAATAC
CGTCTCGTCCTAGCCGTCCCGCAAATCCCCGTCGGACTGGCCCTCGTCAGCTCGCTCTTCCTCGACGACACGCCC
CGCTGGCTCGCAGCCTCACGCGGAGCCGACGCCGCGCTCACGGCTCTAGCCCGTCTACGAGGCCGATCCGAGGTC
GACGCCGCCGTGGTGTCGGAATGGGGCGAGATGCGCCGCCGGCTTGCGGACGAGGAGAAGCATCGGGCGGAATCG
ACGTGGGCGGTTGTCCGGGAGGTGCTGTCCGTGGGCTCGTATCGGCGGCGGTTCCTGCTGGGGTTGGTGGTTCAG
ACGGTTGCGCAGTGGAGTGGTGGCAATGCCATTACTTACTATATTGCCGACATCTTTCGGCTTGCGGGCGTGGCG
ACGAGGAGGCATTCGCTGTTGACGGCTGGGTCGTATGGGGCGACGAAGCTTGTCTTTACTGTTGTTTTTGCTTGG
GGGTTGATCGATTATCTTGGGAGGAGACGGTTCTGGCGAGGATCGTCCAACGGACACAACGAGTCAGCCTCTCAC
GCGGCTGTAGCCTCGGTCTTTGTCTACGCGGTTGGATGGTCCGTCGGGCTCTGCACCGTGCAGTATCTCTACGGC
ACCGAGATCCTGCCCACGCGGGTGCGAGGAGTCTGCTACGCCGTCAACATGGCAGCCCACTGGCTGTTCCAGTTC
GCCGTCGTGGCCGTCATGCCCGCCATGCTGGCCCGTCTGGACGTCTGGGGCGCCTTCGTCTTCTGGGCTGCTGTC
TGTGCTGTTGGTCTGGTGGTGCTTGGGTTGTGGGCGCCTGAGACCAAGGGGGTGGCCATGGAGGATATGGCTGAG
TTGTTTGAGGGGCCTTGTAGCCGACGGTTCTAA
Transcript >Ophun1|6668
ATGGGCTGGTACTTTGTGTTTACCGTCGGGGTGATTGCCTGCGGGTCTATTCCGAAGGGCTACGATGAGGGAGGC
TTCGCCGCCGCCTCCAGCCTCGAATCCTTCATGTCCGACTTCCAGCTCACAACAGGCCGCTGGAACGGCACAGCC
TCGCAGCTAGCCTCTCGGCGAGCCGTCGTCACCTCTCTGGGGGTGCTGGGCGCGGCGGCGGGCGCGGGAGCGGCG
GTGGCGCTGACGGACCGCGTGGGGAGGCTCCGGGCGTGGCAGGCGTTTGTGGCCGTCTGGATGACGGGCTTCCTG
GCGGCTACCATGGCTTCTGGGAGGCTTGGGCTGCTGCTGGTTGCTAGGACCATGCCCCCCTCCCGCTCGCAATAC
CGTCTCGTCCTAGCCGTCCCGCAAATCCCCGTCGGACTGGCCCTCGTCAGCTCGCTCTTCCTCGACGACACGCCC
CGCTGGCTCGCAGCCTCACGCGGAGCCGACGCCGCGCTCACGGCTCTAGCCCGTCTACGAGGCCGATCCGAGGTC
GACGCCGCCGTGGTGTCGGAATGGGGCGAGATGCGCCGCCGGCTTGCGGACGAGGAGAAGCATCGGGCGGAATCG
ACGTGGGCGGTTGTCCGGGAGGTGCTGTCCGTGGGCTCGTATCGGCGGCGGTTCCTGCTGGGGTTGGTGGTTCAG
ACGGTTGCGCAGTGGAGTGGTGGCAATGCCATTACTTACTATATTGCCGACATCTTTCGGCTTGCGGGCGTGGCG
ACGAGGAGGCATTCGCTGTTGACGGCTGGGTCGTATGGGGCGACGAAGCTTGTCTTTACTGTTGTTTTTGCTTGG
GGGTTGATCGATTATCTTGGGAGGAGACGGTTCTGGCGAGGATCGTCCAACGGACACAACGAGTCAGCCTCTCAC
GCGGCTGTAGCCTCGGTCTTTGTCTACGCGGTTGGATGGTCCGTCGGGCTCTGCACCGTGCAGTATCTCTACGGC
ACCGAGATCCTGCCCACGCGGGTGCGAGGAGTCTGCTACGCCGTCAACATGGCAGCCCACTGGCTGTTCCAGTTC
GCCGTCGTGGCCGTCATGCCCGCCATGCTGGCCCGTCTGGACGTCTGGGGCGCCTTCGTCTTCTGGGCTGCTGTC
TGTGCTGTTGGTCTGGTGGTGCTTGGGTTGTGGGCGCCTGAGACCAAGGGGGTGGCCATGGAGGATATGGCTGAG
TTGTTTGAGGGGCCTTGTAGCCGACGGTTCTAA
Gene >Ophun1|6668
ATGGGCTGGTACTTTGTGTTTACCGTCGGGGTGATTGCCTGCGGGTCTATTCCGAAGGGTGAGTCTTGATTCTAT
CTACGAGCATCTAGAGGCATAACTTGGTTGCTGATACGCAGGGCCCAGGCTACGATGAGGGAGGCTTCGCCGCCG
CCTCCAGCCTCGAATCCTTCATGTCCGACTTCCAGCTCACAACAGGCCGCTGGAACGGCACAGCCTCGCAGCTAG
CCTCTCGGCGAGCCGTCGTCACCTCTCTGGGGGTGCTGGGCGCGGCGGCGGGCGCGGGAGCGGCGGTGGCGCTGA
CGGACCGCGTGGGGAGGCTCCGGGCGTGGCAGGCGTTTGTGGCCGTCTGGATGACGGGCTTCCTGGCGGCTACCA
TGGCTTCTGGGAGGCTTGGGCTGCTGCTGGTTGCTAGGGTTTGGGGGGGGGTTGGGGCGGGGGGGTTGACGGTTG
TTGCGCCGCTTTATCTGGCTGAGGTTGCGACGGCGAGGAGGAGGGGGATGGTTGTTTCGGTTTATATGGTTGTGT
TGCTTTCGTTTTTGATGGCTGGTGAGTTGTTCCCCTTGTCCTCGTTGTTTCTTCCGTCCTACATGTTGTTGCTTT
TGTTGTGGTTGTGGTTGTTGTTGTTGTTGTTGTTGTTGTTGTTCCTGTTCTCAACATGAATGACTCAAGGCTTCT
TCGTCAACTACGCCGTCCTCAAGACCATGCCCCCCTCCCGCTCGCAATACCGTCTCGTCCTAGCCGTCCCGCAAA
TCCCCGTCGGACTGGCCCTCGTCAGCTCGCTCTTCCTCGACGACACGCCCCGCTGGCTCGCAGCCTCACGCGGAG
CCGACGCCGCGCTCACGGCTCTAGCCCGTCTACGAGGCCGATCCGAGGTCGACGCCGCCGTGGTGTCGGAATGGG
GCGAGATGCGCCGCCGGCTTGCGGACGAGGAGAAGCATCGGGCGGAATCGACGTGGGCGGTTGTCCGGGAGGTGC
TGTCCGTGGGCTCGTATCGGCGGCGGTTCCTGCTGGGGTTGGTGGTTCAGACGGTTGCGCAGTGGAGTGGTGGCA
ATGCCATTACTTACTATATTGCCGACATCTTTCGGCTTGCGGGCGTGGCGACGAGGAGGCATTCGCTGTTGACGG
CTGGGTCGTATGGGGCGACGAAGCTTGTCTTTACTGTTGTTTTTGCTTGGGGGTTGATCGATTATCTTGGGAGGA
GACGGTGTATGCTGGTTGGGTTGGCGATGCAGGGGGTTGCTCACGCTTACTTGGCTGTTTACATGGCAGTCTGGC
GAGGATCGTCCAACGGACACAACGAGTCAGCCTCTCACGCGGCTGTAGCCTCGGTCTTTGTCTACGCGGTTGGAT
GGTCCGTCGGGCTCTGCACCGTGCAGTATCTCTACGGCACCGAGATCCTGCCCACGCGGGTGCGAGGAGTCTGCT
ACGCCGTCAACATGGCAGCCCACTGGCTGTTCCAGTTCGCCGTCGTGGCCGTCATGCCCGCCATGCTGGCCCGTC
TGGACGTCTGGGGCGCCTTCGTCTTCTGGGCTGCTGTCTGTGCTGTTGGTCTGGTGGTGCTTGGGTTGTGGGCGC
CTGAGACCAAGGGGGTGGCCATGGAGGATATGGCTGAGTTGTTTGAGGGGCCTTGGTATCTTGGATGGCGGGCTC
GGGGGGGGCGTTTGTGTTCGGGGGTTGGGGGTGGTTCGTTGGTGGTTGAAGGGGATGGGAAGGGTAAAGGTGGTG
GGCATTGAGGCAGTTGATCTCTGTTGTTTCTCGCTGGCAGTCATCGATACGCTGTGTCTTTTTGTTCTTTTTCTC
TTAGAACTCGCATCATGTGCTCGAACGGATCGGCCTGCTGTACACGAGGGTCTTGGGCAACTCCCGTCTATCAAC
ATGTTTACCGCACTTGAACTTGACTTGTAGTCTGCTGGCAATGGCGAGAACATGAGTCTTTCTCCCTTTCAGCGT
CTCCTATGGAGATCATTAGATCAACCTACCACAAGCCAACCAACGCAACTACATTAAACTTGAATTGATGTATTG
GAGCCAGTTACATCGCCGGTCAGTACCGCCATCAACGTTGTATCCACGAGACATTGACAATGAAATGGTCACAGA
ATCGATCTATCGACAACATGTAATACAACCCCGAGCCCACACAAGACCACACGACCCATCGTACAAGCAATCCTC
CAACGAACCCTCAAACACACCAACCTTCCTCATTCTTAGGCTCCGAACAGCAGTAATCCTGTCTCCTCGCCCCGT
TATCCTGACACCCTATATCGCAGTAGCCGACGGTTCTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail