Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6659
Gene name
LocationContig_747:3042..4510
Strand-
Gene length (bp)1468
Transcript length (bp)1143
Coding sequence length (bp)1143
Protein length (aa) 381

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00627 UBA UBA/TS-N domain 3.6E-11 140 174
PF00627 UBA UBA/TS-N domain 2.2E-13 333 368
PF09280 XPC-binding XPC-binding domain 1.0E-24 258 313
PF00240 ubiquitin Ubiquitin family 6.1E-18 3 73
PF11976 Rad60-SLD Ubiquitin-2 like Rad60 SUMO-like 4.2E-08 1 64

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 1 377 3.0E-95
sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 1 376 5.0E-67
sp|Q29RK4|RD23B_BOVIN UV excision repair protein RAD23 homolog B OS=Bos taurus GN=RAD23B PE=2 SV=1 1 376 1.0E-66
sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 1 376 3.0E-66
sp|Q4KMA2|RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1 1 376 3.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74803|RHP23_SCHPO UV excision repair protein rhp23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rhp23 PE=1 SV=1 1 377 3.0E-95
sp|P54728|RD23B_MOUSE UV excision repair protein RAD23 homolog B OS=Mus musculus GN=Rad23b PE=1 SV=2 1 376 5.0E-67
sp|Q29RK4|RD23B_BOVIN UV excision repair protein RAD23 homolog B OS=Bos taurus GN=RAD23B PE=2 SV=1 1 376 1.0E-66
sp|P54727|RD23B_HUMAN UV excision repair protein RAD23 homolog B OS=Homo sapiens GN=RAD23B PE=1 SV=1 1 376 3.0E-66
sp|Q4KMA2|RD23B_RAT UV excision repair protein RAD23 homolog B OS=Rattus norvegicus GN=Rad23b PE=1 SV=1 1 376 3.0E-64
sp|P32628|RAD23_YEAST UV excision repair protein RAD23 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RAD23 PE=1 SV=1 1 369 6.0E-61
sp|Q84L33|RD23B_ARATH Ubiquitin receptor RAD23b OS=Arabidopsis thaliana GN=RAD23B PE=1 SV=3 1 376 1.0E-59
sp|A3KMV2|RD23A_BOVIN UV excision repair protein RAD23 homolog A OS=Bos taurus GN=RAD23A PE=2 SV=1 1 376 2.0E-59
sp|Q84L32|RD23A_ARATH Probable ubiquitin receptor RAD23a OS=Arabidopsis thaliana GN=RAD23A PE=1 SV=2 1 376 8.0E-59
sp|P54725|RD23A_HUMAN UV excision repair protein RAD23 homolog A OS=Homo sapiens GN=RAD23A PE=1 SV=1 1 376 3.0E-58
sp|P54726|RD23A_MOUSE UV excision repair protein RAD23 homolog A OS=Mus musculus GN=Rad23a PE=1 SV=2 1 376 3.0E-57
sp|Q84L30|RD23D_ARATH Ubiquitin receptor RAD23d OS=Arabidopsis thaliana GN=RAD23D PE=1 SV=2 1 376 1.0E-55
sp|Q84L31|RD23C_ARATH Ubiquitin receptor RAD23c OS=Arabidopsis thaliana GN=RAD23C PE=1 SV=2 1 376 2.0E-55
sp|Q40742|RAD23_ORYSJ Probable ubiquitin receptor RAD23 OS=Oryza sativa subsp. japonica GN=RAD23 PE=1 SV=2 1 371 1.0E-50
sp|Q54LV1|RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum GN=rcbA PE=1 SV=1 261 375 3.0E-18
sp|Q54LV1|RAD23_DICDI UV excision repair protein RAD23 homolog OS=Dictyostelium discoideum GN=rcbA PE=1 SV=1 1 76 1.0E-12
sp|P48510|DSK2_YEAST Ubiquitin domain-containing protein DSK2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DSK2 PE=1 SV=2 10 75 2.0E-07
sp|O65381|RUB3_ARATH NEDD8-like protein RUB3 OS=Arabidopsis thaliana GN=RUB3 PE=2 SV=1 1 71 6.0E-07
sp|O14399|UBL1_SCHPO Ubiquitin-like protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubl1 PE=3 SV=1 1 62 2.0E-06
sp|P0C031|RUB2_ORYSJ Ubiquitin-NEDD8-like protein RUB2 OS=Oryza sativa subsp. japonica GN=RUB2 PE=2 SV=2 3 71 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006289 nucleotide-excision repair Yes
GO:0003684 damaged DNA binding Yes
GO:0005515 protein binding Yes
GO:0043161 proteasome-mediated ubiquitin-dependent protein catabolic process Yes
GO:0009056 catabolic process No
GO:0019538 protein metabolic process No
GO:0010498 proteasomal protein catabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0051716 cellular response to stimulus No
GO:0043170 macromolecule metabolic process No
GO:0044248 cellular catabolic process No
GO:0044265 cellular macromolecule catabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0050896 response to stimulus No
GO:0030163 protein catabolic process No
GO:0006508 proteolysis No
GO:0006259 DNA metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0006974 cellular response to DNA damage stimulus No
GO:0006950 response to stress No
GO:0043632 modification-dependent macromolecule catabolic process No
GO:1901575 organic substance catabolic process No
GO:0071704 organic substance metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0003676 nucleic acid binding No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0003677 DNA binding No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019941 modification-dependent protein catabolic process No
GO:0003674 molecular_function No
GO:0051603 proteolysis involved in protein catabolic process No
GO:0033554 cellular response to stress No
GO:0006281 DNA repair No
GO:1901565 organonitrogen compound catabolic process No
GO:0009057 macromolecule catabolic process No
GO:0006511 ubiquitin-dependent protein catabolic process No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 46 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6659
MKITFRDLKQQKFSLDVEPTDLVSTLKEMISADKSWDPKHVKLIYSGKILKDDETVESYNIEEKGFVVCMVNKPK
EKPPVAPSNPAAESSAAPSTAPAASSQSASAQATAPATPTPSRPADTPATGAGDSSGLAMGAQRAEAITNMEAMG
FERSQIEAAMRAAFNNPDRAVEYILNGIPENIQQEQQQRAAPAAAVPAPASTQAAPEAQGSDDDGGINLFDLAAQ
QGGGAGASRGGGSASAAAAAAAAAAQGGDLGNLDFLRHNPQFQQLRQVVQQQPQMLEPILQQLGAGNPHLAQLIA
AHPDQFLQLLGEDVDDDVPLPPGAQAISVTEEERDAIERLCRLGFDRDQAIQAYFACDKNEELAANFLFDQPEDD
EPSAN*
Coding >Ophun1|6659
ATGAAGATCACATTTCGGGATTTGAAGCAGCAAAAATTTTCTCTCGACGTCGAGCCCACCGATCTGGTTTCTACC
CTCAAGGAGATGATTTCGGCCGACAAGAGCTGGGACCCCAAACATGTGAAGCTCATCTACTCAGGCAAAATCCTC
AAAGATGATGAGACTGTTGAATCCTACAATATCGAAGAGAAAGGCTTTGTCGTTTGCATGGTAAACAAGCCCAAG
GAGAAGCCTCCAGTTGCCCCATCGAATCCTGCTGCCGAGTCCTCCGCCGCGCCCTCGACGGCGCCTGCTGCGTCT
TCTCAGTCCGCTTCGGCCCAGGCGACGGCGCCCGCTACCCCGACGCCTTCACGTCCCGCTGACACGCCAGCTACA
GGTGCTGGGGATTCGTCTGGTCTCGCCATGGGCGCTCAGCGCGCCGAGGCCATCACCAATATGGAAGCCATGGGT
TTCGAGAGGTCCCAGATCGAGGCTGCGATGCGGGCCGCCTTCAACAACCCCGATCGAGCTGTCGAATACATCCTT
AATGGAATCCCCGAAAACATTCAGCAGGAGCAACAGCAACGCGCCGCCCCCGCCGCCGCTGTCCCTGCTCCCGCC
TCCACCCAAGCAGCTCCCGAAGCCCAAGGAAGCGACGACGACGGCGGCATCAACCTCTTCGATCTCGCTGCCCAA
CAGGGAGGTGGTGCCGGGGCGTCCCGAGGCGGCGGAAGCGCTTCTGCCGCTGCTGCCGCTGCCGCTGCCGCCGCT
CAGGGCGGAGATCTCGGCAATCTGGACTTCCTGAGACATAACCCGCAGTTCCAGCAGCTCCGCCAAGTCGTCCAG
CAACAGCCTCAGATGCTGGAGCCTATTCTGCAGCAACTCGGAGCAGGGAACCCGCACCTGGCCCAGCTCATCGCC
GCCCACCCCGACCAGTTCCTTCAGCTTCTCGGAGAGGACGTGGATGATGATGTGCCTCTGCCCCCTGGCGCGCAG
GCCATCTCCGTGACTGAGGAAGAGCGCGATGCCATCGAACGGTTATGTAGGCTAGGCTTCGATCGAGACCAGGCC
ATTCAAGCCTACTTCGCCTGCGACAAGAATGAGGAACTGGCGGCCAACTTCCTCTTTGATCAGCCCGAAGACGAC
GAACCCTCTGCAAATTGA
Transcript >Ophun1|6659
ATGAAGATCACATTTCGGGATTTGAAGCAGCAAAAATTTTCTCTCGACGTCGAGCCCACCGATCTGGTTTCTACC
CTCAAGGAGATGATTTCGGCCGACAAGAGCTGGGACCCCAAACATGTGAAGCTCATCTACTCAGGCAAAATCCTC
AAAGATGATGAGACTGTTGAATCCTACAATATCGAAGAGAAAGGCTTTGTCGTTTGCATGGTAAACAAGCCCAAG
GAGAAGCCTCCAGTTGCCCCATCGAATCCTGCTGCCGAGTCCTCCGCCGCGCCCTCGACGGCGCCTGCTGCGTCT
TCTCAGTCCGCTTCGGCCCAGGCGACGGCGCCCGCTACCCCGACGCCTTCACGTCCCGCTGACACGCCAGCTACA
GGTGCTGGGGATTCGTCTGGTCTCGCCATGGGCGCTCAGCGCGCCGAGGCCATCACCAATATGGAAGCCATGGGT
TTCGAGAGGTCCCAGATCGAGGCTGCGATGCGGGCCGCCTTCAACAACCCCGATCGAGCTGTCGAATACATCCTT
AATGGAATCCCCGAAAACATTCAGCAGGAGCAACAGCAACGCGCCGCCCCCGCCGCCGCTGTCCCTGCTCCCGCC
TCCACCCAAGCAGCTCCCGAAGCCCAAGGAAGCGACGACGACGGCGGCATCAACCTCTTCGATCTCGCTGCCCAA
CAGGGAGGTGGTGCCGGGGCGTCCCGAGGCGGCGGAAGCGCTTCTGCCGCTGCTGCCGCTGCCGCTGCCGCCGCT
CAGGGCGGAGATCTCGGCAATCTGGACTTCCTGAGACATAACCCGCAGTTCCAGCAGCTCCGCCAAGTCGTCCAG
CAACAGCCTCAGATGCTGGAGCCTATTCTGCAGCAACTCGGAGCAGGGAACCCGCACCTGGCCCAGCTCATCGCC
GCCCACCCCGACCAGTTCCTTCAGCTTCTCGGAGAGGACGTGGATGATGATGTGCCTCTGCCCCCTGGCGCGCAG
GCCATCTCCGTGACTGAGGAAGAGCGCGATGCCATCGAACGGTTATGTAGGCTAGGCTTCGATCGAGACCAGGCC
ATTCAAGCCTACTTCGCCTGCGACAAGAATGAGGAACTGGCGGCCAACTTCCTCTTTGATCAGCCCGAAGACGAC
GAACCCTCTGCAAATTGA
Gene >Ophun1|6659
ATGAAGATCACATTTCGGGTACAGACTGTCCCCTCCATACCCCGAGATCTACTCACGCTGACTTTCTGCAGGATT
TGAAGCAGCAAAAATTTTCTCTCGACGTCGAGCCCACCGATCTGGTACGCCCGCGCCCTCTTCTTTCCCTCTCCA
TGTCTGCTTACGCCTCTCAGGTTTCTACCCTCAAGGAGATGATTTCGGCCGACAAGAGCTGGGACCCCAAACATG
TGAAGCTCATCTACTCAGGTCAGAAAGCCCCGTCTCTCCTCCCGTCTTGTTTCGTCTCTGACGTGAAGCAGGCAA
AATCCTCAAAGATGATGAGACTGTTGAATCCTACAATATCGAAGAGAAAGGCTTTGTCGTTTGCATGGTAAACAA
GGTATGTCCGCATACCAGAGCAAACCTCTGCCTCGAAACTGACCCTTCTGGCCTCCAGCCCAAGGAGAAGCCTCC
AGTTGCCCCATCGAATCCTGCTGCCGAGTCCTCCGCCGCGCCCTCGACGGCGCCTGCTGCGTCTTCTCAGTCCGC
TTCGGCCCAGGCGACGGCGCCCGCTACCCCGACGCCTTCACGTCCCGCTGACACGCCAGCTACAGGTGCTGGGGA
TTCGTCTGGTCTCGCCATGGGCGCTCAGCGCGCCGAGGCCATCACCAATATGGAAGCCATGGGTTTCGAGAGGTC
CCAGATCGAGGCTGCGATGCGGGCCGCCTTCAACAACCCCGATCGAGCTGTCGAATACATCCTTAATGTGTGTTC
TTGCCGCCCCTCTCCCCTCTAACGTCGCTGTCGCTGACAAGATTTCAGGGAATCCCCGAAAACATTCAGCAGGAG
CAACAGCAACGCGCCGCCCCCGCCGCCGCTGTCCCTGCTCCCGCCTCCACCCAAGCAGCTCCCGAAGCCCAAGGA
AGCGACGACGACGGCGGCATCAACCTCTTCGATCTCGCTGCCCAACAGGGAGGTGGTGCCGGGGCGTCCCGAGGC
GGCGGAAGCGCTTCTGCCGCTGCTGCCGCTGCCGCTGCCGCCGCTCAGGGCGGAGATCTCGGCAATCTGGACTTC
CTGAGACATAACCCGCAGTTCCAGCAGCTCCGCCAAGTCGTCCAGCAACAGCCTCAGATGCTGGAGCCTATTCTG
CAGCAACTCGGAGCAGGGAACCCGCACCTGGCCCAGCTCATCGCCGCCCACCCCGACCAGTTCCTTCAGCTTCTC
GGAGAGGACGTGGATGATGATGTGCCTCTGCCCCCTGGCGCGCAGGCCATCTCCGTGACTGAGGAAGAGCGCGAT
GCCATCGAACGGGTATGTCTTCCACACTCGTCGGTGAGCAAGCTCTGCTGACGTTTGTCGACATTAGTTATGTAG
GCTAGGCTTCGATCGAGACCAGGCCATTCAAGCCTACTTCGCCTGCGACAAGAATGAGGAACTGGCGGCCAACTT
CCTCTTTGATCAGCCCGAAGACGACGAACCCTCTGCAAATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail