Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6640
Gene name
LocationContig_741:333..678
Strand-
Gene length (bp)345
Transcript length (bp)345
Coding sequence length (bp)345
Protein length (aa) 115

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 16 0.99964

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5753
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-floridani Ophcf2|06019
Ophiocordyceps camponoti-rufipedis Ophun1|6640 (this protein)
Ophiocordyceps kimflemingae Ophio5|6304
Ophiocordyceps subramaniannii Hirsu2|9275
Ophiocordyceps subramaniannii Hirsu2|947

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6640
MHSLQFLVLAIAGALAAPSIDHVSTYESAFDKSGLVRRGATYGQVCGQNRIAHCCKDVERKQGRNGLIPIDLGRC
SRIEILSDLIHGSCNGQVCCAGATKGVSLISLQCTDIQI*
Coding >Ophun1|6640
ATGCACTCCCTCCAGTTCCTCGTCCTCGCCATCGCCGGCGCCCTCGCCGCCCCTTCCATCGACCACGTCAGCACC
TACGAATCCGCCTTTGACAAGTCGGGCCTCGTCCGCCGCGGCGCCACCTACGGCCAAGTCTGCGGCCAGAACCGC
ATCGCCCACTGCTGCAAGGACGTCGAGAGGAAGCAGGGACGCAACGGCCTGATCCCCATCGATCTCGGCCGCTGC
AGCCGCATCGAGATTCTCTCGGATCTGATTCACGGCAGCTGCAACGGTCAGGTCTGCTGCGCTGGAGCCACCAAG
GGCGTCAGCCTCATCAGCCTTCAGTGCACCGACATTCAGATTTAG
Transcript >Ophun1|6640
ATGCACTCCCTCCAGTTCCTCGTCCTCGCCATCGCCGGCGCCCTCGCCGCCCCTTCCATCGACCACGTCAGCACC
TACGAATCCGCCTTTGACAAGTCGGGCCTCGTCCGCCGCGGCGCCACCTACGGCCAAGTCTGCGGCCAGAACCGC
ATCGCCCACTGCTGCAAGGACGTCGAGAGGAAGCAGGGACGCAACGGCCTGATCCCCATCGATCTCGGCCGCTGC
AGCCGCATCGAGATTCTCTCGGATCTGATTCACGGCAGCTGCAACGGTCAGGTCTGCTGCGCTGGAGCCACCAAG
GGCGTCAGCCTCATCAGCCTTCAGTGCACCGACATTCAGATTTAG
Gene >Ophun1|6640
ATGCACTCCCTCCAGTTCCTCGTCCTCGCCATCGCCGGCGCCCTCGCCGCCCCTTCCATCGACCACGTCAGCACC
TACGAATCCGCCTTTGACAAGTCGGGCCTCGTCCGCCGCGGCGCCACCTACGGCCAAGTCTGCGGCCAGAACCGC
ATCGCCCACTGCTGCAAGGACGTCGAGAGGAAGCAGGGACGCAACGGCCTGATCCCCATCGATCTCGGCCGCTGC
AGCCGCATCGAGATTCTCTCGGATCTGATTCACGGCAGCTGCAACGGTCAGGTCTGCTGCGCTGGAGCCACCAAG
GGCGTCAGCCTCATCAGCCTTCAGTGCACCGACATTCAGATTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail