Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6635
Gene name
LocationContig_74:36047..37696
Strand+
Gene length (bp)1649
Transcript length (bp)1533
Coding sequence length (bp)1533
Protein length (aa) 511

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01479 S4 S4 domain 1.2E-10 154 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27929|NAM9_YEAST 37S ribosomal protein NAM9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM9 PE=1 SV=2 10 244 3.0E-35
sp|P27929|NAM9_YEAST 37S ribosomal protein NAM9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM9 PE=1 SV=2 401 510 7.0E-14
sp|O60063|NAM9_SCHPO 37S ribosomal protein S4-like, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nam9 PE=2 SV=1 433 507 1.0E-10
sp|O60063|NAM9_SCHPO 37S ribosomal protein S4-like, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nam9 PE=2 SV=1 135 217 2.0E-10
sp|A4YRT2|RS4_BRASO 30S ribosomal protein S4 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsD PE=3 SV=1 152 203 5.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27929|NAM9_YEAST 37S ribosomal protein NAM9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM9 PE=1 SV=2 10 244 3.0E-35
sp|P27929|NAM9_YEAST 37S ribosomal protein NAM9, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NAM9 PE=1 SV=2 401 510 7.0E-14
sp|O60063|NAM9_SCHPO 37S ribosomal protein S4-like, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nam9 PE=2 SV=1 433 507 1.0E-10
sp|O60063|NAM9_SCHPO 37S ribosomal protein S4-like, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nam9 PE=2 SV=1 135 217 2.0E-10
sp|A4YRT2|RS4_BRASO 30S ribosomal protein S4 OS=Bradyrhizobium sp. (strain ORS278) GN=rpsD PE=3 SV=1 152 203 5.0E-09
sp|A5EMG8|RS4_BRASB 30S ribosomal protein S4 OS=Bradyrhizobium sp. (strain BTAi1 / ATCC BAA-1182) GN=rpsD PE=3 SV=1 152 203 5.0E-09
sp|O66484|RS4_AQUAE 30S ribosomal protein S4 OS=Aquifex aeolicus (strain VF5) GN=rpsD PE=3 SV=1 146 203 5.0E-09
sp|B3EGW4|RS4_CHLL2 30S ribosomal protein S4 OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=rpsD PE=3 SV=1 152 202 3.0E-08
sp|Q97J08|RS4B_CLOAB Putative 30S ribosomal protein S4 B OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsD2 PE=3 SV=1 152 199 5.0E-08
sp|C0QQQ0|RS4_PERMH 30S ribosomal protein S4 OS=Persephonella marina (strain DSM 14350 / EX-H1) GN=rpsD PE=3 SV=1 146 203 7.0E-08
sp|A7HM25|RS4_FERNB 30S ribosomal protein S4 OS=Fervidobacterium nodosum (strain ATCC 35602 / DSM 5306 / Rt17-B1) GN=rpsD PE=3 SV=1 150 203 7.0E-08
sp|A1BJ08|RS4_CHLPD 30S ribosomal protein S4 OS=Chlorobium phaeobacteroides (strain DSM 266) GN=rpsD PE=3 SV=1 152 202 1.0E-07
sp|Q05FK4|RS4_CARRP 30S ribosomal protein S4 OS=Carsonella ruddii (strain PV) GN=rpsD PE=3 SV=1 152 204 1.0E-07
sp|Q0W1V5|RS4_METAR 30S ribosomal protein S4 OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rps4 PE=3 SV=1 152 193 1.0E-07
sp|B7IHX2|RS4_THEAB 30S ribosomal protein S4 OS=Thermosipho africanus (strain TCF52B) GN=rpsD PE=3 SV=1 152 203 2.0E-07
sp|B0KCM7|RS4_THEP3 30S ribosomal protein S4 OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=rpsD PE=3 SV=1 152 203 2.0E-07
sp|B0K5S0|RS4_THEPX 30S ribosomal protein S4 OS=Thermoanaerobacter sp. (strain X514) GN=rpsD PE=3 SV=1 152 203 2.0E-07
sp|B1M7L0|RS4_METRJ 30S ribosomal protein S4 OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=rpsD PE=3 SV=1 152 203 2.0E-07
sp|Q89ID3|RS4_BRADU 30S ribosomal protein S4 OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=rpsD PE=3 SV=1 152 203 2.0E-07
sp|Q9KXP5|RS4_STRCO 30S ribosomal protein S4 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=rpsD PE=3 SV=1 152 203 2.0E-07
sp|B1W3H7|RS4_STRGG 30S ribosomal protein S4 OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=rpsD PE=3 SV=1 152 203 3.0E-07
sp|A8F4T8|RS4_PSELT 30S ribosomal protein S4 OS=Pseudothermotoga lettingae (strain ATCC BAA-301 / DSM 14385 / NBRC 107922 / TMO) GN=rpsD PE=3 SV=1 152 203 3.0E-07
sp|Q2S936|RS4_HAHCH 30S ribosomal protein S4 OS=Hahella chejuensis (strain KCTC 2396) GN=rpsD PE=3 SV=1 152 203 3.0E-07
sp|B0RZT8|RS4_FINM2 30S ribosomal protein S4 OS=Finegoldia magna (strain ATCC 29328) GN=rpsD PE=3 SV=1 152 203 3.0E-07
sp|Q3ST14|RS4_NITWN 30S ribosomal protein S4 OS=Nitrobacter winogradskyi (strain Nb-255 / ATCC 25391) GN=rpsD PE=3 SV=1 152 203 3.0E-07
sp|Q1IS94|RS4_KORVE 30S ribosomal protein S4 OS=Koribacter versatilis (strain Ellin345) GN=rpsD PE=3 SV=1 146 203 3.0E-07
sp|Q8R7Y1|RS4_CALS4 30S ribosomal protein S4 OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=rpsD PE=3 SV=1 152 203 3.0E-07
sp|Q0AQX8|RS4_MARMM 30S ribosomal protein S4 OS=Maricaulis maris (strain MCS10) GN=rpsD PE=3 SV=1 146 203 4.0E-07
sp|A8MDS5|RS4_CALMQ 30S ribosomal protein S4 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=rps4 PE=3 SV=1 150 193 4.0E-07
sp|A8I889|RS4_AZOC5 30S ribosomal protein S4 OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=rpsD PE=3 SV=1 152 203 4.0E-07
sp|C1CXD5|RS4_DEIDV 30S ribosomal protein S4 OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=rpsD PE=3 SV=1 142 203 4.0E-07
sp|Q5ZZW4|RS4_MYCH2 30S ribosomal protein S4 OS=Mycoplasma hyopneumoniae (strain 232) GN=rpsD PE=3 SV=1 151 227 4.0E-07
sp|Q4A9B0|RS4_MYCHJ 30S ribosomal protein S4 OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=rpsD PE=3 SV=1 151 227 4.0E-07
sp|B9KZW1|RS4_THERP 30S ribosomal protein S4 OS=Thermomicrobium roseum (strain ATCC 27502 / DSM 5159 / P-2) GN=rpsD PE=3 SV=1 152 203 4.0E-07
sp|B5YG23|RS4_THEYD 30S ribosomal protein S4 OS=Thermodesulfovibrio yellowstonii (strain ATCC 51303 / DSM 11347 / YP87) GN=rpsD PE=3 SV=1 152 203 4.0E-07
sp|Q4A7F0|RS4_MYCH7 30S ribosomal protein S4 OS=Mycoplasma hyopneumoniae (strain 7448) GN=rpsD PE=3 SV=1 151 227 4.0E-07
sp|A9W966|RS4_METEP 30S ribosomal protein S4 OS=Methylobacterium extorquens (strain PA1) GN=rpsD PE=3 SV=1 152 203 5.0E-07
sp|B7KVN1|RS4_METC4 30S ribosomal protein S4 OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=rpsD PE=3 SV=1 152 203 5.0E-07
sp|B1ZAP8|RS4_METPB 30S ribosomal protein S4 OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=rpsD PE=3 SV=1 152 203 5.0E-07
sp|Q0TMU2|RS4B_CLOP1 30S ribosomal protein S4 B OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=rpsD2 PE=3 SV=1 152 199 5.0E-07
sp|Q6F0M9|RS4_MESFL 30S ribosomal protein S4 OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=rpsD PE=3 SV=1 152 203 5.0E-07
sp|Q0SQI8|RS4B_CLOPS 30S ribosomal protein S4 B OS=Clostridium perfringens (strain SM101 / Type A) GN=rpsD2 PE=3 SV=1 152 199 5.0E-07
sp|Q8XHW7|RS4B_CLOPE Putative 30S ribosomal protein S4 B OS=Clostridium perfringens (strain 13 / Type A) GN=rpsD2 PE=3 SV=1 152 199 5.0E-07
sp|Q1QMT5|RS4_NITHX 30S ribosomal protein S4 OS=Nitrobacter hamburgensis (strain X14 / DSM 10229) GN=rpsD PE=3 SV=1 152 203 5.0E-07
sp|A0B9L2|RS4_METTP 30S ribosomal protein S4 OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rps4 PE=3 SV=1 152 204 6.0E-07
sp|Q13A88|RS4_RHOPS 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain BisB5) GN=rpsD PE=3 SV=1 152 203 7.0E-07
sp|Q97IP6|RS4C_CLOAB Putative 30S ribosomal protein S4 C OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=rpsD3 PE=3 SV=1 152 200 7.0E-07
sp|A6TNW5|RS4C_ALKMQ 30S ribosomal protein S4 C OS=Alkaliphilus metalliredigens (strain QYMF) GN=rpsD3 PE=3 SV=1 146 199 7.0E-07
sp|B0UDI8|RS4_METS4 30S ribosomal protein S4 OS=Methylobacterium sp. (strain 4-46) GN=rpsD PE=3 SV=1 152 203 7.0E-07
sp|B3Q7H1|RS4_RHOPT 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain TIE-1) GN=rpsD PE=3 SV=1 152 203 8.0E-07
sp|Q6N9G0|RS4_RHOPA 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=rpsD PE=1 SV=3 152 203 8.0E-07
sp|Q6AP44|RS4_DESPS 30S ribosomal protein S4 OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=rpsD PE=3 SV=1 152 203 9.0E-07
sp|Q83EQ3|RS4_COXBU 30S ribosomal protein S4 OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|A9NAZ4|RS4_COXBR 30S ribosomal protein S4 OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|A9KD07|RS4_COXBN 30S ribosomal protein S4 OS=Coxiella burnetii (strain Dugway 5J108-111) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|B6J239|RS4_COXB2 30S ribosomal protein S4 OS=Coxiella burnetii (strain CbuG_Q212) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|Q218M1|RS4_RHOPB 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain BisB18) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|C5CGH5|RS4_KOSOT 30S ribosomal protein S4 OS=Kosmotoga olearia (strain TBF 19.5.1) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|B9L6T8|RS4_NAUPA 30S ribosomal protein S4 OS=Nautilia profundicola (strain ATCC BAA-1463 / DSM 18972 / AmH) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|Q2ITR6|RS4_RHOP2 30S ribosomal protein S4 OS=Rhodopseudomonas palustris (strain HaA2) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|Q827S7|RS4_STRAW 30S ribosomal protein S4 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|B8IB09|RS4_METNO 30S ribosomal protein S4 OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=rpsD PE=3 SV=1 152 203 1.0E-06
sp|B2V7I6|RS4_SULSY 30S ribosomal protein S4 OS=Sulfurihydrogenibium sp. (strain YO3AOP1) GN=rpsD PE=3 SV=1 139 203 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 15 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6635
MRRPPRYYHLAKPKLRASWNKHVLYNLSRDVGTEPKVDLQRTFFQQKWAAKSKTRAYHGDHIPEKKWVRLFSRRL
LSVVDMPPQYLAAYDGSEQAAGRGSGLQTSTVTAETYSSAPEYISAKLSTRKGHVNKLLSLKHNQMTPYMQMTFA
PLERRLETAIFRSLFASSVREARQLCIHGAVKVNGMKMIYPGYQLNPGDMFQVDVDKVLYATGEQKNPGLLPCLR
WRRNDRLWWRELWAQIKTKATASKDKKPAEGNSETMLKGKQSGTMPKEKSETKPQEKKSETKPQEKKSVSPWRLK
QMMVEFTLKMVIARLEIQDEEKGILDRRLRRFRLTARRWLSLPDDFEMPPARLMYALWQLFAHPELAPKLSERWL
LKSGAVDEKKPMTNQLRAMDHLLRGDITEQLKFKYQEMAMGSVTISPTKMLQITKLLEQLEEKLVDGKEPYATPW
RPRPFMPAFAFIPRYLEVNPYICAGVYLRHPVARKGLAEVPTPFSYLTSQLAHNWYLGRG*
Coding >Ophun1|6635
ATGCGCAGACCGCCACGATACTATCATCTGGCAAAGCCTAAACTACGCGCGTCGTGGAACAAGCACGTCCTTTAC
AATCTCTCTCGCGACGTCGGAACCGAGCCCAAGGTCGATCTCCAGAGGACTTTTTTCCAACAGAAATGGGCGGCC
AAATCCAAGACAAGAGCCTATCACGGCGACCACATCCCCGAGAAGAAGTGGGTGCGCCTCTTCTCCCGCCGGCTT
CTGTCCGTGGTCGATATGCCTCCGCAGTACCTCGCAGCCTACGACGGCTCTGAGCAAGCTGCTGGCCGAGGGTCG
GGCCTACAGACATCGACGGTCACGGCCGAAACCTACTCCTCGGCCCCCGAATATATCTCCGCAAAACTGTCCACG
CGAAAGGGTCATGTCAACAAGTTGCTCTCGTTGAAACATAATCAAATGACGCCTTATATGCAAATGACGTTTGCG
CCCTTGGAGCGGAGGTTGGAGACTGCCATATTCCGCTCGCTCTTCGCAAGCAGTGTTCGCGAGGCGCGGCAGTTG
TGCATTCACGGAGCTGTCAAGGTCAATGGCATGAAGATGATCTATCCGGGTTACCAACTCAATCCAGGTGACATG
TTCCAAGTCGATGTCGACAAGGTCCTGTACGCCACCGGGGAACAAAAAAACCCTGGCCTCCTGCCTTGCCTTCGC
TGGCGCAGAAATGATCGACTGTGGTGGCGGGAACTGTGGGCGCAAATCAAAACGAAAGCGACAGCTTCAAAGGAT
AAGAAACCCGCCGAGGGGAACTCCGAGACCATGCTCAAGGGGAAGCAATCCGGCACCATGCCCAAGGAGAAATCC
GAGACCAAGCCCCAGGAGAAGAAATCCGAGACCAAGCCCCAGGAGAAGAAATCCGTGTCACCCTGGCGTCTGAAG
CAAATGATGGTCGAATTTACCCTCAAGATGGTGATCGCAAGGCTTGAAATTCAGGACGAGGAAAAGGGGATCCTA
GATAGGAGACTCCGTCGCTTCAGACTAACCGCCAGGCGGTGGCTGTCACTGCCCGATGACTTTGAGATGCCTCCT
GCAAGACTGATGTACGCGCTGTGGCAGTTGTTCGCTCACCCTGAGCTGGCTCCGAAGTTGAGCGAGCGGTGGTTG
CTAAAGTCAGGCGCAGTCGATGAGAAGAAGCCAATGACGAACCAACTGCGCGCCATGGATCACTTGCTACGCGGC
GACATTACTGAGCAGCTGAAATTTAAGTATCAGGAAATGGCCATGGGTTCTGTCACCATCAGCCCTACGAAGATG
CTCCAGATCACGAAGCTGCTTGAGCAACTGGAGGAGAAACTGGTGGATGGAAAGGAGCCCTACGCCACGCCGTGG
CGGCCTCGACCGTTCATGCCTGCTTTCGCCTTCATTCCTCGCTATCTCGAGGTCAACCCCTACATCTGCGCTGGC
GTCTATCTCCGCCACCCGGTGGCAAGGAAAGGCTTAGCTGAGGTGCCGACGCCATTCAGCTATTTGACGAGCCAG
CTGGCACACAACTGGTACCTGGGTCGCGGCTAA
Transcript >Ophun1|6635
ATGCGCAGACCGCCACGATACTATCATCTGGCAAAGCCTAAACTACGCGCGTCGTGGAACAAGCACGTCCTTTAC
AATCTCTCTCGCGACGTCGGAACCGAGCCCAAGGTCGATCTCCAGAGGACTTTTTTCCAACAGAAATGGGCGGCC
AAATCCAAGACAAGAGCCTATCACGGCGACCACATCCCCGAGAAGAAGTGGGTGCGCCTCTTCTCCCGCCGGCTT
CTGTCCGTGGTCGATATGCCTCCGCAGTACCTCGCAGCCTACGACGGCTCTGAGCAAGCTGCTGGCCGAGGGTCG
GGCCTACAGACATCGACGGTCACGGCCGAAACCTACTCCTCGGCCCCCGAATATATCTCCGCAAAACTGTCCACG
CGAAAGGGTCATGTCAACAAGTTGCTCTCGTTGAAACATAATCAAATGACGCCTTATATGCAAATGACGTTTGCG
CCCTTGGAGCGGAGGTTGGAGACTGCCATATTCCGCTCGCTCTTCGCAAGCAGTGTTCGCGAGGCGCGGCAGTTG
TGCATTCACGGAGCTGTCAAGGTCAATGGCATGAAGATGATCTATCCGGGTTACCAACTCAATCCAGGTGACATG
TTCCAAGTCGATGTCGACAAGGTCCTGTACGCCACCGGGGAACAAAAAAACCCTGGCCTCCTGCCTTGCCTTCGC
TGGCGCAGAAATGATCGACTGTGGTGGCGGGAACTGTGGGCGCAAATCAAAACGAAAGCGACAGCTTCAAAGGAT
AAGAAACCCGCCGAGGGGAACTCCGAGACCATGCTCAAGGGGAAGCAATCCGGCACCATGCCCAAGGAGAAATCC
GAGACCAAGCCCCAGGAGAAGAAATCCGAGACCAAGCCCCAGGAGAAGAAATCCGTGTCACCCTGGCGTCTGAAG
CAAATGATGGTCGAATTTACCCTCAAGATGGTGATCGCAAGGCTTGAAATTCAGGACGAGGAAAAGGGGATCCTA
GATAGGAGACTCCGTCGCTTCAGACTAACCGCCAGGCGGTGGCTGTCACTGCCCGATGACTTTGAGATGCCTCCT
GCAAGACTGATGTACGCGCTGTGGCAGTTGTTCGCTCACCCTGAGCTGGCTCCGAAGTTGAGCGAGCGGTGGTTG
CTAAAGTCAGGCGCAGTCGATGAGAAGAAGCCAATGACGAACCAACTGCGCGCCATGGATCACTTGCTACGCGGC
GACATTACTGAGCAGCTGAAATTTAAGTATCAGGAAATGGCCATGGGTTCTGTCACCATCAGCCCTACGAAGATG
CTCCAGATCACGAAGCTGCTTGAGCAACTGGAGGAGAAACTGGTGGATGGAAAGGAGCCCTACGCCACGCCGTGG
CGGCCTCGACCGTTCATGCCTGCTTTCGCCTTCATTCCTCGCTATCTCGAGGTCAACCCCTACATCTGCGCTGGC
GTCTATCTCCGCCACCCGGTGGCAAGGAAAGGCTTAGCTGAGGTGCCGACGCCATTCAGCTATTTGACGAGCCAG
CTGGCACACAACTGGTACCTGGGTCGCGGCTAA
Gene >Ophun1|6635
ATGCGCAGACCGCCACGATACTATCATCTGGCAAAGCCTGTGAGCTATTAGTATCTACTTTGGTCGCGTCCAATT
GCTGACAGCGAGTCCCCGGATCAGAAACTACGCGCGTCGTGGAACAAGCACGTCCTTTACAATCTCTCTCGCGAC
GTCGGAACCGAGCCCAAGGTCGATCTCCAGAGGACTTTTTTCCAACAGAAATGGGCGGCCAAATCCAAGACAAGA
GCCTATCACGGCGACCACATCCCCGAGAAGAAGTGGGTGCGCCTCTTCTCCCGCCGGCTTCTGTCCGTGGTCGAT
ATGCCTCCGCAGTACCTCGCAGCCTACGACGGCTCTGAGCAAGCTGCTGGCCGAGGGTCGGGCCTACAGACATCG
ACGGTCACGGCCGAAACCTACTCCTCGGCCCCCGAATATATCTCCGCAAAACTGTCCACGCGAAAGGGTCATGTC
AACAAGTTGCTCTCGTTGAAACATAATCAAATGACGCCTTATATGCAAATGACGTTTGCGCCCTTGGAGCGGAGG
TTGGAGACTGCCATATTCCGCTCGCTCTTCGCAAGCAGTGTTCGCGAGGCGCGGCAGTTGTGCATTCACGGAGCT
GTCAAGGTCAATGGCATGAAGGTCGGGCGCTGTGTCTCCATGTTGACTTTTCCAGGCAATTCGTTGACTTAGTGC
AGATGATCTATCCGGGTTACCAACTCAATCCAGGTGACATGTTCCAAGTCGATGTCGACAAGGTCCTGTACGCCA
CCGGGGAACAAAAAAACCCTGGCCTCCTGCCTTGCCTTCGCTGGCGCAGAAATGATCGACTGTGGTGGCGGGAAC
TGTGGGCGCAAATCAAAACGAAAGCGACAGCTTCAAAGGATAAGAAACCCGCCGAGGGGAACTCCGAGACCATGC
TCAAGGGGAAGCAATCCGGCACCATGCCCAAGGAGAAATCCGAGACCAAGCCCCAGGAGAAGAAATCCGAGACCA
AGCCCCAGGAGAAGAAATCCGTGTCACCCTGGCGTCTGAAGCAAATGATGGTCGAATTTACCCTCAAGATGGTGA
TCGCAAGGCTTGAAATTCAGGACGAGGAAAAGGGGATCCTAGATAGGAGACTCCGTCGCTTCAGACTAACCGCCA
GGCGGTGGCTGTCACTGCCCGATGACTTTGAGATGCCTCCTGCAAGACTGATGTACGCGCTGTGGCAGTTGTTCG
CTCACCCTGAGCTGGCTCCGAAGTTGAGCGAGCGGTGGTTGCTAAAGTCAGGCGCAGTCGATGAGAAGAAGCCAA
TGACGAACCAACTGCGCGCCATGGATCACTTGCTACGCGGCGACATTACTGAGCAGCTGAAATTTAAGTATCAGG
AAATGGCCATGGGTTCTGTCACCATCAGCCCTACGAAGATGCTCCAGATCACGAAGCTGCTTGAGCAACTGGAGG
AGAAACTGGTGGATGGAAAGGAGCCCTACGCCACGCCGTGGCGGCCTCGACCGTTCATGCCTGCTTTCGCCTTCA
TTCCTCGCTATCTCGAGGTCAACCCCTACATCTGCGCTGGCGTCTATCTCCGCCACCCGGTGGCAAGGAAAGGCT
TAGCTGAGGTGCCGACGCCATTCAGCTATTTGACGAGCCAGCTGGCACACAACTGGTACCTGGGTCGCGGCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail