Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6634
Gene name
LocationContig_74:32780..35691
Strand-
Gene length (bp)2911
Transcript length (bp)2835
Coding sequence length (bp)2835
Protein length (aa) 945

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00004 AAA ATPase family associated with various cellular activities (AAA) 7.8E-11 284 412
PF07728 AAA_5 AAA domain (dynein-related subfamily) 2.9E-05 284 364

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1D3|CTF18_EMENI Chromosome transmission fidelity protein 18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ctf18 PE=3 SV=1 127 944 0.0E+00
sp|Q9USQ1|CTF18_SCHPO Chromosome transmission fidelity protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf18 PE=1 SV=1 211 943 7.0E-63
sp|P49956|CTF18_YEAST Chromosome transmission fidelity protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF18 PE=1 SV=1 223 758 2.0E-45
sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 18 homolog OS=Xenopus laevis GN=chtf18 PE=2 SV=1 217 941 7.0E-42
sp|Q8BIW9|CTF18_MOUSE Chromosome transmission fidelity protein 18 homolog OS=Mus musculus GN=Chtf18 PE=1 SV=2 215 941 7.0E-33
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P0C1D3|CTF18_EMENI Chromosome transmission fidelity protein 18 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=ctf18 PE=3 SV=1 127 944 0.0E+00
sp|Q9USQ1|CTF18_SCHPO Chromosome transmission fidelity protein 18 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ctf18 PE=1 SV=1 211 943 7.0E-63
sp|P49956|CTF18_YEAST Chromosome transmission fidelity protein 18 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CTF18 PE=1 SV=1 223 758 2.0E-45
sp|Q6NU40|CTF18_XENLA Chromosome transmission fidelity protein 18 homolog OS=Xenopus laevis GN=chtf18 PE=2 SV=1 217 941 7.0E-42
sp|Q8BIW9|CTF18_MOUSE Chromosome transmission fidelity protein 18 homolog OS=Mus musculus GN=Chtf18 PE=1 SV=2 215 941 7.0E-33
sp|Q8WVB6|CTF18_HUMAN Chromosome transmission fidelity protein 18 homolog OS=Homo sapiens GN=CHTF18 PE=1 SV=1 213 941 2.0E-30
sp|O60182|RFC1_SCHPO Replication factor C subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rfc1 PE=1 SV=1 216 478 1.0E-26
sp|Q2R2B4|RFC1_ORYSJ Replication factor C subunit 1 OS=Oryza sativa subsp. japonica GN=RFC1 PE=2 SV=2 221 480 1.0E-21
sp|A1RWU6|RFCL_THEPD Replication factor C large subunit OS=Thermofilum pendens (strain Hrk 5) GN=rfcL PE=3 SV=1 224 496 3.0E-21
sp|P35601|RFC1_MOUSE Replication factor C subunit 1 OS=Mus musculus GN=Rfc1 PE=1 SV=2 203 464 1.0E-20
sp|P38630|RFC1_YEAST Replication factor C subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RFC1 PE=1 SV=1 223 480 4.0E-20
sp|A3MS27|RFCL_PYRCJ Replication factor C large subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcL PE=3 SV=1 224 480 2.0E-19
sp|A9A6N2|RFCL_METM6 Replication factor C large subunit OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rfcL PE=3 SV=1 224 541 4.0E-19
sp|Q54MH9|RFC1_DICDI Probable replication factor C subunit 1 OS=Dictyostelium discoideum GN=rfc1 PE=3 SV=1 222 474 1.0E-18
sp|A6VIW1|RFCL_METM7 Replication factor C large subunit OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rfcL PE=3 SV=1 224 541 1.0E-18
sp|A4FZL6|RFCL_METM5 Replication factor C large subunit OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rfcL PE=3 SV=1 224 475 2.0E-18
sp|P35251|RFC1_HUMAN Replication factor C subunit 1 OS=Homo sapiens GN=RFC1 PE=1 SV=4 222 464 2.0E-18
sp|Q6M0E9|RFCL_METMP Replication factor C large subunit OS=Methanococcus maripaludis (strain S2 / LL) GN=rfcL PE=3 SV=1 224 475 3.0E-18
sp|O29072|RFCL_ARCFU Replication factor C large subunit OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rfcL PE=1 SV=1 222 480 3.0E-18
sp|A4WGV3|RFCL_PYRAR Replication factor C large subunit OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=rfcL PE=3 SV=1 221 480 4.0E-18
sp|A6UWR5|RFCL_META3 Replication factor C large subunit OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rfcL PE=3 SV=1 224 498 6.0E-18
sp|Q8ZYK3|RFCL_PYRAE Replication factor C large subunit OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcL PE=3 SV=1 221 480 8.0E-18
sp|Q9YBS5|RFCL_AERPE Replication factor C large subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcL PE=3 SV=2 224 516 1.0E-17
sp|B1YC69|RFCL_PYRNV Replication factor C large subunit OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rfcL PE=3 SV=1 224 480 1.0E-17
sp|P35600|RFC1_DROME Replication factor C subunit 1 OS=Drosophila melanogaster GN=Gnf1 PE=1 SV=2 221 478 2.0E-17
sp|A1RSA3|RFCL_PYRIL Replication factor C large subunit OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcL PE=3 SV=1 221 480 3.0E-17
sp|Q58294|RFCL_METJA Replication factor C large subunit OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rfcL PE=1 SV=1 222 476 5.0E-17
sp|Q975D4|RFCL_SULTO Replication factor C large subunit OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rfcL PE=3 SV=2 222 476 9.0E-17
sp|C3MVD2|RFCL_SULIM Replication factor C large subunit OS=Sulfolobus islandicus (strain M.14.25 / Kamchatka #1) GN=rfcL PE=3 SV=1 224 476 3.0E-16
sp|C3N5N1|RFCL_SULIA Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.27) GN=rfcL PE=3 SV=1 224 476 3.0E-16
sp|C4KHA7|RFCL_SULIK Replication factor C large subunit OS=Sulfolobus islandicus (strain M.16.4 / Kamchatka #3) GN=rfcL PE=3 SV=1 224 476 7.0E-16
sp|A6URV8|RFCL_METVS Replication factor C large subunit OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rfcL PE=3 SV=1 224 435 8.0E-16
sp|A5UMF4|RFCL_METS3 Replication factor C large subunit OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rfcL PE=3 SV=1 222 480 1.0E-15
sp|Q8Q084|RFCL_METMA Replication factor C large subunit OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=rfcL PE=3 SV=1 217 480 1.0E-15
sp|C3NHF4|RFCL_SULIN Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.N.15.51 / Yellowstone #2) GN=rfcL PE=3 SV=1 224 476 2.0E-15
sp|C3NE95|RFCL_SULIY Replication factor C large subunit OS=Sulfolobus islandicus (strain Y.G.57.14 / Yellowstone #1) GN=rfcL PE=3 SV=1 224 476 2.0E-15
sp|C3MQ13|RFCL_SULIL Replication factor C large subunit OS=Sulfolobus islandicus (strain L.S.2.15 / Lassen #1) GN=rfcL PE=3 SV=1 224 476 2.0E-15
sp|A8AC24|RFCL_IGNH4 Replication factor C large subunit OS=Ignicoccus hospitalis (strain KIN4/I / DSM 18386 / JCM 14125) GN=rfcL PE=3 SV=1 221 476 5.0E-15
sp|Q46AT6|RFCL_METBF Replication factor C large subunit OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=rfcL PE=3 SV=1 221 480 1.0E-14
sp|Q4JAB1|RFCL_SULAC Replication factor C large subunit OS=Sulfolobus acidocaldarius (strain ATCC 33909 / DSM 639 / JCM 8929 / NBRC 15157 / NCIMB 11770) GN=rfcL PE=3 SV=1 222 476 2.0E-14
sp|A3DNV8|RFCL_STAMF Replication factor C large subunit OS=Staphylothermus marinus (strain ATCC 43588 / DSM 3639 / JCM 9404 / F1) GN=rfcL PE=3 SV=1 224 475 2.0E-14
sp|O26342|RFCL_METTH Replication factor C large subunit OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rfcL PE=1 SV=1 224 500 7.0E-14
sp|Q9UXF6|RFCL_SULSO Replication factor C large subunit OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rfcL PE=1 SV=1 224 477 8.0E-14
sp|Q8TPU4|RFCL_METAC Replication factor C large subunit OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=rfcL PE=3 SV=1 217 480 1.0E-13
sp|Q8TZC5|RFCL_METKA Replication factor C large subunit OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rfcL PE=3 SV=1 224 480 2.0E-13
sp|B9LPV1|RFCL_HALLT Replication factor C large subunit OS=Halorubrum lacusprofundi (strain ATCC 49239 / DSM 5036 / JCM 8891 / ACAM 34) GN=rfcL PE=3 SV=1 224 476 6.0E-13
sp|Q18GQ9|RFCL_HALWD Replication factor C large subunit OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=rfcL PE=3 SV=1 224 500 8.0E-13
sp|A2SQR6|RFCL_METLZ Replication factor C large subunit OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=rfcL PE=3 SV=1 224 480 1.0E-12
sp|A2BL93|RFCL_HYPBU Replication factor C large subunit OS=Hyperthermus butylicus (strain DSM 5456 / JCM 9403 / PLM1-5) GN=rfcL PE=3 SV=1 224 476 2.0E-12
sp|Q2NH88|RFCL_METST Replication factor C large subunit OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rfcL PE=3 SV=1 222 498 2.0E-12
sp|Q0W3P4|RFCL_METAR Replication factor C large subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcL PE=3 SV=1 224 486 4.0E-12
sp|A3CTR4|RFCL_METMJ Replication factor C large subunit OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=rfcL PE=3 SV=1 224 480 7.0E-12
sp|Q5V1F7|RFCL_HALMA Replication factor C large subunit OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rfcL PE=3 SV=1 224 476 7.0E-11
sp|A1RV38|RFCS2_PYRIL Replication factor C small subunit 2 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS2 PE=3 SV=1 222 480 9.0E-11
sp|A7I781|RFCL_METB6 Replication factor C large subunit OS=Methanoregula boonei (strain 6A8) GN=rfcL PE=3 SV=1 224 480 1.0E-10
sp|Q9C587|RFC1_ARATH Replication factor C subunit 1 OS=Arabidopsis thaliana GN=RFC1 PE=2 SV=1 219 480 2.0E-10
sp|Q8ZWS2|RFCS2_PYRAE Replication factor C small subunit 2 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS2 PE=3 SV=1 222 480 5.0E-10
sp|A0B6D7|RFCL_METTP Replication factor C large subunit OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=rfcL PE=3 SV=1 224 471 8.0E-10
sp|Q2FQR4|RFCL_METHJ Replication factor C large subunit OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=rfcL PE=3 SV=1 224 476 1.0E-09
sp|Q9YBS7|RFCS_AERPE Replication factor C small subunit OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rfcS PE=3 SV=3 222 488 1.0E-09
sp|Q5JHP1|RFCL_THEKO Replication factor C large subunit OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rfcL PE=1 SV=1 224 319 2.0E-09
sp|Q12TX1|RFCL_METBU Replication factor C large subunit OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=rfcL PE=3 SV=1 224 480 3.0E-09
sp|O57853|RFCL_PYRHO Replication factor C large subunit OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rfcL PE=3 SV=1 219 323 4.0E-09
sp|Q8ZYK4|RFCS1_PYRAE Replication factor C small subunit 1 OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rfcS1 PE=3 SV=1 222 480 5.0E-09
sp|Q9UWR2|RFCL_PYRFU Replication factor C large subunit OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rfcL PE=1 SV=1 220 319 8.0E-09
sp|Q9HIP7|RFCL_THEAC Replication factor C large subunit OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rfcL PE=3 SV=1 224 373 9.0E-09
sp|Q9HPI4|RFCL_HALSA Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rfcL PE=3 SV=2 224 324 1.0E-08
sp|B0R601|RFCL_HALS3 Replication factor C large subunit OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rfcL PE=3 SV=1 224 324 1.0E-08
sp|Q3ISA5|RFCL_NATPD Replication factor C large subunit OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=rfcL PE=3 SV=1 224 500 2.0E-08
sp|Q9V2G3|RFCL_PYRAB Replication factor C large subunit OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rfcL PE=1 SV=3 219 323 2.0E-08
sp|Q4QY64|ATAD5_MOUSE ATPase family AAA domain-containing protein 5 OS=Mus musculus GN=Atad5 PE=1 SV=1 222 342 2.0E-08
sp|P60373|RFCL_NANEQ Replication factor C large subunit OS=Nanoarchaeum equitans (strain Kin4-M) GN=rfcL PE=3 SV=1 273 386 6.0E-08
sp|A1RSA2|RFCS1_PYRIL Replication factor C small subunit 1 OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rfcS1 PE=3 SV=1 222 484 7.0E-08
sp|Q97BC2|RFCL_THEVO Replication factor C large subunit OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rfcL PE=3 SV=1 224 476 2.0E-07
sp|Q0W037|RFCS_METAR Replication factor C small subunit OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=rfcS PE=3 SV=1 223 367 4.0E-07
sp|Q5UP47|RFCS3_MIMIV Putative replication factor C small subunit L499 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L499 PE=3 SV=1 210 499 7.0E-07
sp|Q7XRX1|RFC4_ORYSJ Replication factor C subunit 4 OS=Oryza sativa subsp. japonica GN=RFC4 PE=2 SV=2 284 369 2.0E-06
sp|A3MS28|RFCS_PYRCJ Replication factor C small subunit OS=Pyrobaculum calidifontis (strain JCM 11548 / VA1) GN=rfcS PE=3 SV=1 222 367 3.0E-06
sp|O74111|RFC3_BLAAD Replication factor C subunit 3 OS=Blastobotrys adeninivorans GN=RFC3 PE=3 SV=1 216 336 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0016887 ATP hydrolysis activity Yes
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0032555 purine ribonucleotide binding No
GO:0032553 ribonucleotide binding No
GO:0036094 small molecule binding No
GO:0003824 catalytic activity No
GO:0097367 carbohydrate derivative binding No
GO:0016818 hydrolase activity, acting on acid anhydrides, in phosphorus-containing anhydrides No
GO:0097159 organic cyclic compound binding No
GO:0016817 hydrolase activity, acting on acid anhydrides No
GO:0032559 adenyl ribonucleotide binding No
GO:1901363 heterocyclic compound binding No
GO:0030554 adenyl nucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0003674 molecular_function No
GO:0017111 nucleoside-triphosphatase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0005488 binding No
GO:0016462 pyrophosphatase activity No
GO:0016787 hydrolase activity No
GO:0000166 nucleotide binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6634
MLSSSSPITFPTSSPPPVTRPPQQENRPPKRRVQGPFILEDSGSEAETDDPALFHRAKRRMLHAAGEQETPPETA
ERNEECIQSQQEVPATQPEGFPSPVPETLPSASAHPDSLFSGLISDVALSASYRFNTCRGQAFTIKERRTHVAPS
YESMVAARSRTKEGRAIRSYYGIEMNELLSQVFIDSWQQKQPLPPGATDYNGRGHAAENTIATAGQKPQPALLWT
EKYRARAFDDLCGDDGTNRKVLRWLKKWDPLVFNRTSQSTFRRPWGKFHAEEKPHRKILMLTGPPGLGKTTLAHV
CASHAGYEVMEINASDDRSRNVVKDRIRTSLGTQSVKTVVNASSARAPSEPARPLCVVVDEVDGVTSGSGASGEG
GFVKALMDLIQVDERNASASLFTAEGSRKKQKGDDFRQMRPLILICNDVYHPSLRPLRQSNLAEIIYVGRPSLEA
VVSRLTMVFEEEGVACEKDAVRKLCEAVWGVSSGPNAKRDVESPVDGDIRGIMVVGEWVAGRFRSTTNRAERPVM
TRDWIEDNVLEDLANGAGGARALGSSSVRDIVSRLFQEGAGFPQPNVDKAKSWATQENPQIEHAVSEQLKKQATE
RLSAMVNASGDISSIVTDMFTEYADRDYNDDCYLTKPNQGYDWLYFHDACQSRLYTSQEWELAPYLSQPVLAYHH
LFASPRRYLGPAKADDSRPPVPFSGPRADYQAREAERQNRAQLQALHGQLTPWLMRAFRSADDLACDFLPYLVRM
LSPEVNPVVISGSQGPIVSVRREDDKTRLRRASEILADTGIALQKGRIESESFAGREAPDYVYRMDPDVDALAFF
ETSTSTHTPTRFAVRQALDQELQRTLAARSASARQARFLAGDTSASCAAAPPPEAAILEAKTETAPMTVVRTDFF
GRVSVEPLKPVIEAPREDTWLAFSEGFSLAVQRPVSVEDLMRML*
Coding >Ophun1|6634
ATGTTATCGAGTTCCTCGCCCATCACGTTCCCCACCAGCTCGCCACCTCCCGTCACGCGGCCTCCTCAACAAGAG
AACCGTCCACCGAAGCGGCGTGTACAAGGGCCTTTCATTCTCGAAGATTCCGGATCGGAAGCCGAAACGGACGAC
CCGGCCCTTTTCCACAGGGCAAAAAGGCGTATGCTGCATGCTGCCGGAGAACAAGAAACCCCGCCTGAAACCGCC
GAGAGAAACGAAGAATGCATCCAGAGCCAGCAAGAAGTGCCGGCTACCCAGCCCGAAGGCTTTCCGTCTCCAGTA
CCTGAAACTCTGCCATCGGCCTCTGCACACCCAGATTCGCTGTTCTCCGGTTTGATCTCCGACGTCGCCCTATCC
GCATCTTACAGATTCAATACTTGCCGCGGACAGGCATTCACCATCAAAGAACGTCGCACACATGTCGCCCCGTCA
TACGAGTCCATGGTCGCCGCGAGGTCCAGAACGAAGGAGGGCAGAGCGATCCGAAGCTACTACGGCATTGAGATG
AATGAACTTTTGTCTCAGGTTTTCATAGACTCGTGGCAGCAGAAGCAGCCTCTGCCGCCGGGAGCCACCGACTAT
AACGGGCGCGGGCATGCCGCAGAGAACACTATAGCGACGGCGGGACAAAAGCCGCAGCCAGCCTTACTATGGACG
GAAAAGTACCGCGCTCGCGCTTTCGATGACCTGTGCGGCGACGACGGCACAAATCGAAAGGTGCTGCGGTGGCTC
AAGAAATGGGATCCACTGGTCTTCAACCGGACAAGCCAGTCGACTTTCCGGAGGCCGTGGGGCAAGTTCCATGCA
GAGGAAAAGCCGCACCGGAAGATATTGATGCTCACGGGACCCCCGGGGCTGGGCAAGACGACGCTGGCCCACGTC
TGCGCGTCTCATGCCGGCTACGAAGTCATGGAGATCAACGCGAGCGATGACCGAAGTCGCAACGTCGTCAAGGAC
CGTATCCGCACGAGCCTCGGCACGCAGAGCGTCAAGACGGTCGTCAACGCGAGTAGCGCCAGGGCACCGTCAGAG
CCAGCCAGGCCACTTTGCGTGGTAGTCGACGAGGTCGATGGCGTAACTTCAGGTTCCGGCGCGTCTGGCGAGGGC
GGCTTCGTGAAAGCCCTGATGGATCTGATCCAGGTTGATGAGAGAAACGCGTCGGCCAGCTTGTTCACCGCAGAG
GGCAGCCGGAAGAAACAGAAAGGAGACGACTTTCGACAAATGCGGCCGCTCATACTCATCTGCAACGATGTATAT
CATCCGTCACTTCGGCCCCTGAGGCAGTCCAACCTAGCGGAAATCATCTACGTCGGACGACCGTCGTTGGAGGCA
GTCGTCAGTCGGCTAACGATGGTCTTCGAGGAGGAGGGCGTGGCCTGCGAAAAGGACGCAGTCAGGAAGTTGTGC
GAGGCGGTCTGGGGCGTTTCCAGCGGCCCGAACGCGAAACGAGACGTTGAGAGCCCCGTAGACGGCGACATCCGG
GGCATCATGGTTGTGGGCGAGTGGGTTGCCGGCCGGTTCCGTTCAACGACGAACCGGGCAGAGCGGCCCGTCATG
ACCCGGGACTGGATCGAGGACAACGTGCTGGAAGACCTGGCCAACGGAGCAGGGGGTGCTCGGGCCCTCGGCAGC
AGCAGCGTCAGGGACATCGTCTCCCGTCTCTTCCAGGAGGGCGCCGGCTTCCCCCAGCCAAACGTCGACAAGGCC
AAGTCATGGGCCACGCAAGAGAACCCGCAGATCGAGCACGCCGTCAGCGAACAGCTGAAGAAGCAGGCAACAGAA
CGCCTCAGCGCCATGGTCAACGCCAGCGGCGACATCAGCAGCATCGTCACGGACATGTTCACCGAGTACGCCGAT
CGCGACTACAACGACGACTGCTACCTGACCAAGCCCAATCAAGGCTACGACTGGCTCTACTTCCACGACGCCTGC
CAGTCGCGCCTCTACACCAGCCAGGAGTGGGAGCTGGCACCGTACCTGAGTCAACCGGTGCTAGCATATCACCAT
CTCTTCGCCTCACCCAGGCGATATCTCGGCCCGGCCAAAGCCGACGACTCCCGTCCGCCCGTACCCTTCTCCGGC
CCTCGTGCCGACTACCAAGCTCGAGAGGCCGAGCGCCAAAACCGCGCCCAGCTGCAGGCTCTGCATGGCCAATTG
ACCCCCTGGCTGATGCGCGCATTCCGCAGCGCCGACGACCTTGCCTGCGACTTTCTGCCCTACCTCGTCCGCATG
CTGTCTCCCGAAGTCAATCCCGTCGTCATCAGCGGCAGTCAGGGCCCCATAGTCAGCGTCCGCCGCGAAGACGAC
AAGACGAGGTTAAGACGAGCATCGGAGATTCTCGCGGATACGGGCATTGCCCTGCAAAAGGGAAGAATCGAAAGC
GAGTCGTTTGCCGGCCGTGAAGCTCCCGACTATGTCTATCGCATGGATCCAGACGTCGACGCCCTCGCATTCTTC
GAAACAAGCACCTCGACCCATACTCCAACCCGCTTCGCCGTCCGCCAAGCCCTCGACCAGGAACTCCAGCGCACG
CTGGCAGCCCGCAGCGCATCCGCCCGACAAGCCCGCTTCCTCGCAGGCGACACCTCGGCGTCTTGTGCCGCCGCG
CCCCCGCCAGAGGCCGCCATCCTAGAGGCGAAGACGGAAACAGCGCCGATGACGGTGGTGAGGACGGACTTTTTC
GGCCGCGTTTCCGTGGAGCCCCTGAAACCTGTCATTGAGGCGCCGAGGGAGGATACGTGGCTCGCATTCAGTGAG
GGCTTTAGTTTAGCGGTGCAGAGGCCCGTCTCGGTCGAGGACCTGATGCGCATGCTGTGA
Transcript >Ophun1|6634
ATGTTATCGAGTTCCTCGCCCATCACGTTCCCCACCAGCTCGCCACCTCCCGTCACGCGGCCTCCTCAACAAGAG
AACCGTCCACCGAAGCGGCGTGTACAAGGGCCTTTCATTCTCGAAGATTCCGGATCGGAAGCCGAAACGGACGAC
CCGGCCCTTTTCCACAGGGCAAAAAGGCGTATGCTGCATGCTGCCGGAGAACAAGAAACCCCGCCTGAAACCGCC
GAGAGAAACGAAGAATGCATCCAGAGCCAGCAAGAAGTGCCGGCTACCCAGCCCGAAGGCTTTCCGTCTCCAGTA
CCTGAAACTCTGCCATCGGCCTCTGCACACCCAGATTCGCTGTTCTCCGGTTTGATCTCCGACGTCGCCCTATCC
GCATCTTACAGATTCAATACTTGCCGCGGACAGGCATTCACCATCAAAGAACGTCGCACACATGTCGCCCCGTCA
TACGAGTCCATGGTCGCCGCGAGGTCCAGAACGAAGGAGGGCAGAGCGATCCGAAGCTACTACGGCATTGAGATG
AATGAACTTTTGTCTCAGGTTTTCATAGACTCGTGGCAGCAGAAGCAGCCTCTGCCGCCGGGAGCCACCGACTAT
AACGGGCGCGGGCATGCCGCAGAGAACACTATAGCGACGGCGGGACAAAAGCCGCAGCCAGCCTTACTATGGACG
GAAAAGTACCGCGCTCGCGCTTTCGATGACCTGTGCGGCGACGACGGCACAAATCGAAAGGTGCTGCGGTGGCTC
AAGAAATGGGATCCACTGGTCTTCAACCGGACAAGCCAGTCGACTTTCCGGAGGCCGTGGGGCAAGTTCCATGCA
GAGGAAAAGCCGCACCGGAAGATATTGATGCTCACGGGACCCCCGGGGCTGGGCAAGACGACGCTGGCCCACGTC
TGCGCGTCTCATGCCGGCTACGAAGTCATGGAGATCAACGCGAGCGATGACCGAAGTCGCAACGTCGTCAAGGAC
CGTATCCGCACGAGCCTCGGCACGCAGAGCGTCAAGACGGTCGTCAACGCGAGTAGCGCCAGGGCACCGTCAGAG
CCAGCCAGGCCACTTTGCGTGGTAGTCGACGAGGTCGATGGCGTAACTTCAGGTTCCGGCGCGTCTGGCGAGGGC
GGCTTCGTGAAAGCCCTGATGGATCTGATCCAGGTTGATGAGAGAAACGCGTCGGCCAGCTTGTTCACCGCAGAG
GGCAGCCGGAAGAAACAGAAAGGAGACGACTTTCGACAAATGCGGCCGCTCATACTCATCTGCAACGATGTATAT
CATCCGTCACTTCGGCCCCTGAGGCAGTCCAACCTAGCGGAAATCATCTACGTCGGACGACCGTCGTTGGAGGCA
GTCGTCAGTCGGCTAACGATGGTCTTCGAGGAGGAGGGCGTGGCCTGCGAAAAGGACGCAGTCAGGAAGTTGTGC
GAGGCGGTCTGGGGCGTTTCCAGCGGCCCGAACGCGAAACGAGACGTTGAGAGCCCCGTAGACGGCGACATCCGG
GGCATCATGGTTGTGGGCGAGTGGGTTGCCGGCCGGTTCCGTTCAACGACGAACCGGGCAGAGCGGCCCGTCATG
ACCCGGGACTGGATCGAGGACAACGTGCTGGAAGACCTGGCCAACGGAGCAGGGGGTGCTCGGGCCCTCGGCAGC
AGCAGCGTCAGGGACATCGTCTCCCGTCTCTTCCAGGAGGGCGCCGGCTTCCCCCAGCCAAACGTCGACAAGGCC
AAGTCATGGGCCACGCAAGAGAACCCGCAGATCGAGCACGCCGTCAGCGAACAGCTGAAGAAGCAGGCAACAGAA
CGCCTCAGCGCCATGGTCAACGCCAGCGGCGACATCAGCAGCATCGTCACGGACATGTTCACCGAGTACGCCGAT
CGCGACTACAACGACGACTGCTACCTGACCAAGCCCAATCAAGGCTACGACTGGCTCTACTTCCACGACGCCTGC
CAGTCGCGCCTCTACACCAGCCAGGAGTGGGAGCTGGCACCGTACCTGAGTCAACCGGTGCTAGCATATCACCAT
CTCTTCGCCTCACCCAGGCGATATCTCGGCCCGGCCAAAGCCGACGACTCCCGTCCGCCCGTACCCTTCTCCGGC
CCTCGTGCCGACTACCAAGCTCGAGAGGCCGAGCGCCAAAACCGCGCCCAGCTGCAGGCTCTGCATGGCCAATTG
ACCCCCTGGCTGATGCGCGCATTCCGCAGCGCCGACGACCTTGCCTGCGACTTTCTGCCCTACCTCGTCCGCATG
CTGTCTCCCGAAGTCAATCCCGTCGTCATCAGCGGCAGTCAGGGCCCCATAGTCAGCGTCCGCCGCGAAGACGAC
AAGACGAGGTTAAGACGAGCATCGGAGATTCTCGCGGATACGGGCATTGCCCTGCAAAAGGGAAGAATCGAAAGC
GAGTCGTTTGCCGGCCGTGAAGCTCCCGACTATGTCTATCGCATGGATCCAGACGTCGACGCCCTCGCATTCTTC
GAAACAAGCACCTCGACCCATACTCCAACCCGCTTCGCCGTCCGCCAAGCCCTCGACCAGGAACTCCAGCGCACG
CTGGCAGCCCGCAGCGCATCCGCCCGACAAGCCCGCTTCCTCGCAGGCGACACCTCGGCGTCTTGTGCCGCCGCG
CCCCCGCCAGAGGCCGCCATCCTAGAGGCGAAGACGGAAACAGCGCCGATGACGGTGGTGAGGACGGACTTTTTC
GGCCGCGTTTCCGTGGAGCCCCTGAAACCTGTCATTGAGGCGCCGAGGGAGGATACGTGGCTCGCATTCAGTGAG
GGCTTTAGTTTAGCGGTGCAGAGGCCCGTCTCGGTCGAGGACCTGATGCGCATGCTGTGA
Gene >Ophun1|6634
ATGTTATCGAGTTCCTCGCCCATCACGTTCCCCACCAGCTCGCCACCTCCCGTCACGCGGCCTCCTCAACAAGAG
AACCGTCCACCGAAGCGGCGTGTACAAGGGCCTTTCATTCTCGAAGATTCCGGATCGGAAGCCGAAACGGACGAC
CCGGCCCTTTTCCACAGGGCAAAAAGGCGTATGCTGCATGCTGCCGGAGAACAAGAAACCCCGCCTGAAACCGCC
GAGAGAAACGAAGAATGCATCCAGAGCCAGCAAGAAGTGCCGGCTACCCAGCCCGAAGGCTTTCCGTCTCCAGTA
CCTGAAACTCTGCCATCGGCCTCTGCACACCCAGATTCGCTGTTCTCCGGTTTGATCTCCGACGTCGCCCTATCC
GCATCTTACAGATTCAATACTTGCCGCGGACAGGCATTCACCATCAAAGAACGTCGCACACATGTCGCCCCGTCA
TACGAGTCCATGGTCGCCGCGAGGTCCAGAACGAAGGAGGGCAGAGCGATCCGAAGCTACTACGGCATTGAGATG
AATGAACTTTTGTCTCAGGTTTTCATAGACTCGTGGCAGCAGAAGCAGCCTCTGCCGCCGGGAGCCACCGACTAT
AACGGGCGCGGGCATGCCGCAGAGAACACTATAGCGACGGCGGGACAAAAGCCGCAGCCAGCCTTACTATGGACG
GAAAAGTACCGCGCTCGCGCTTTCGATGACCTGTGCGGCGACGACGGCACAAATCGAAAGGTGCTGCGGTGGCTC
AAGAAATGGGATCCACTGGTCTTCAACCGGACAAGCCAGTCGACTTTCCGGAGGCCGTGGGGCAAGTTCCATGCA
GAGGAAAAGCCGCACCGGAAGATATTGATGCTCACGGGACCCCCGGGGCTGGGCAAGACGACGCTGGCCCACGTC
TGCGCGTCTCATGCCGGCTACGAAGTCATGGAGATCAACGCGAGCGATGACCGAAGTCGCAACGTCGTCAAGGAC
CGTATCCGCACGAGCCTCGGCACGCAGAGCGTCAAGACGGTCGTCAACGCGAGTAGCGCCAGGGCACCGTCAGAG
CCAGCCAGGCCACTTTGCGTGGTAGTCGACGAGGTCGATGGCGTAACTTCAGGTTCCGGCGCGTCTGGCGAGGGC
GGCTTCGTGAAAGCCCTGATGGATCTGATCCAGGTTGATGAGAGAAACGCGTCGGCCAGCTTGTTCACCGCAGAG
GGCAGCCGGAAGAAACAGAAAGGAGACGACTTTCGACAAATGCGGCCGCTCATACTCATCTGCAACGATGTATAT
CATCCGTCACTTCGGCCCCTGAGGCAGTCCAACCTAGCGGAAATCATCTACGTCGGACGACCGTCGTTGGAGGCA
GTCGTCAGTCGGCTAACGATGGTCTTCGAGGAGGAGGGCGTGGCCTGCGAAAAGGACGCAGTCAGGAAGTTGTGC
GAGGCGGTCTGGGGCGTTTCCAGCGGCCCGAACGCGAAACGAGACGTTGAGAGCCCCGTAGACGGCGACATCCGG
GGCATCATGGTTGTGGGCGAGTGGGTTGCCGGCCGGTTCCGTTCAACGACGAACCGGGCAGAGCGGCCCGTCATG
ACCCGGGACTGGATCGAGGACAACGTGCTGGAAGACCTGGCCAACGGAGCAGGGGGTGCTCGGGCCCTCGGCAGC
AGCAGCGTCAGGGACATCGTCTCCCGTCTCTTCCAGGAGGGCGCCGGCTTCCCCCAGCCAAACGTCGACAAGGCC
AAGTCATGGGCCACGCAAGAGAACCCGCAGATCGAGCACGCCGTCAGCGAACAGCTGAAGAAGCAGGCAACAGAA
CGCCTCAGCGCCATGGTCAACGCCAGCGGCGACATCAGCAGCATCGTCACGGACATGTTCACCGAGTACGCCGAT
CGCGACTACAACGACGACTGCTACCTGACCAAGCCCAATCAAGGCTACGACTGGCTCTACTTCCACGACGCCTGC
CAGTCGCGCCTCTACACCAGCCAGGAGTGGGAGCTGGCACCGTACCTGAGTCAACCGGTGCTAGCATATCACCAT
CTCTTCGCCTCACCCAGGCGATATCTCGGCCCGGCCAAAGCCGACGACTCCCGTCCGCCCGTACCCTTCTCCGGC
CCTCGTGCCGACTACCAAGCTCGAGAGGCCGAGCGCCAAAACCGCGCCCAGCTGCAGGCTCTGCATGGCCAATTG
ACCCCCTGGCTGATGCGCGCATTCCGCAGCGCCGACGACCTTGCCTGCGACTTTCTGCCCTACCTCGTCCGCATG
CTGTCTCCCGAAGTCAATCCCGTCGTCATCAGCGGCAGTCAGGGCCCCATAGTCAGCGTCCGCCGCGAAGACGAC
AAGACGAGGTTAAGACGAGCATCGGAGATTCTCGCGGATACGGGCATTGCCCTGCAAAAGGGAAGAATCGAAAGC
GAGTCGTTTGCCGGCCGTGAAGCTCCCGACTATGTCTATCGCATGGATCCGTACGTCTCCTACCGACCCCCTTTC
ATCCCCCTTTTTCTACGTTTTTGCTGACCACAAACACTCACACAAACGCAGAGACGTCGACGCCCTCGCATTCTT
CGAAACAAGCACCTCGACCCATACTCCAACCCGCTTCGCCGTCCGCCAAGCCCTCGACCAGGAACTCCAGCGCAC
GCTGGCAGCCCGCAGCGCATCCGCCCGACAAGCCCGCTTCCTCGCAGGCGACACCTCGGCGTCTTGTGCCGCCGC
GCCCCCGCCAGAGGCCGCCATCCTAGAGGCGAAGACGGAAACAGCGCCGATGACGGTGGTGAGGACGGACTTTTT
CGGCCGCGTTTCCGTGGAGCCCCTGAAACCTGTCATTGAGGCGCCGAGGGAGGATACGTGGCTCGCATTCAGTGA
GGGCTTTAGTTTAGCGGTGCAGAGGCCCGTCTCGGTCGAGGACCTGATGCGCATGCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail