Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6633
Gene name
LocationContig_74:30726..32458
Strand+
Gene length (bp)1732
Transcript length (bp)1455
Coding sequence length (bp)1455
Protein length (aa) 485

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01070 FMN_dh FMN-dependent dehydrogenase 3.5E-107 119 449
PF00173 Cyt-b5 Cytochrome b5-like Heme/Steroid binding domain 1.0E-21 7 76
PF01645 Glu_synthase Conserved region in glutamate synthase 6.4E-07 358 410

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 8 461 0.0E+00
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 7 471 4.0E-166
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 2 449 3.0E-99
sp|Q24JJ8|GLO3_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Arabidopsis thaliana GN=GLO3 PE=2 SV=1 106 457 5.0E-84
sp|Q9LJH5|GLO4_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Arabidopsis thaliana GN=GLO4 PE=2 SV=1 106 441 1.0E-82
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P09437|CYB2_WICAO Cytochrome b2, mitochondrial OS=Wickerhamomyces anomalus GN=CYB2 PE=1 SV=2 8 461 0.0E+00
sp|P00175|CYB2_YEAST Cytochrome b2, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB2 PE=1 SV=1 7 471 4.0E-166
sp|P32953|CYBL_RHOGR (S)-mandelate dehydrogenase, mitochondrial OS=Rhodotorula graminis PE=1 SV=2 2 449 3.0E-99
sp|Q24JJ8|GLO3_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Arabidopsis thaliana GN=GLO3 PE=2 SV=1 106 457 5.0E-84
sp|Q9LJH5|GLO4_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Arabidopsis thaliana GN=GLO4 PE=2 SV=1 106 441 1.0E-82
sp|Q8H3I4|GLO4_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. japonica GN=GLO4 PE=2 SV=2 111 440 2.0E-80
sp|O49506|GLO5_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Arabidopsis thaliana GN=GLO5 PE=1 SV=1 108 443 4.0E-80
sp|B8B8K5|GLO4_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO4 OS=Oryza sativa subsp. indica GN=GLO4 PE=3 SV=2 111 440 3.0E-77
sp|Q9LRS0|GLO2_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Arabidopsis thaliana GN=GLO2 PE=1 SV=1 108 443 3.0E-76
sp|Q9LRR9|GLO1_ARATH Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Arabidopsis thaliana GN=GLO1 PE=1 SV=1 108 443 5.0E-76
sp|Q9UJM8|HAOX1_HUMAN Hydroxyacid oxidase 1 OS=Homo sapiens GN=HAO1 PE=1 SV=1 109 448 5.0E-75
sp|Q9WU19|HAOX1_MOUSE Hydroxyacid oxidase 1 OS=Mus musculus GN=Hao1 PE=1 SV=1 105 448 6.0E-75
sp|P05414|GOX_SPIOL Peroxisomal (S)-2-hydroxy-acid oxidase OS=Spinacia oleracea PE=1 SV=1 108 443 1.0E-74
sp|Q7FAS1|GLO3_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. japonica GN=GLO3 PE=2 SV=1 111 443 1.0E-74
sp|B8AUI3|GLO3_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO3 OS=Oryza sativa subsp. indica GN=GLO3 PE=3 SV=1 111 443 1.0E-74
sp|Q6YT73|GLO5_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. japonica GN=GLO5 PE=2 SV=1 106 440 3.0E-74
sp|B8B7C5|GLO5_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO5 OS=Oryza sativa subsp. indica GN=GLO5 PE=3 SV=1 106 440 3.0E-74
sp|Q10CE4|GLO1_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. japonica GN=GLO1 PE=1 SV=1 106 440 2.0E-72
sp|B8AKX6|GLO1_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO1 OS=Oryza sativa subsp. indica GN=GLO1 PE=3 SV=1 106 440 2.0E-72
sp|Q7XPR4|GLO2_ORYSJ Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Oryza sativa subsp. japonica GN=GLO2 PE=3 SV=3 111 443 1.0E-70
sp|Q01KC2|GLO2_ORYSI Peroxisomal (S)-2-hydroxy-acid oxidase GLO2 OS=Oryza sativa subsp. indica GN=GLO2 PE=3 SV=2 111 443 1.0E-70
sp|Q3ZBW2|HAOX2_BOVIN Hydroxyacid oxidase 2 OS=Bos taurus GN=HAO2 PE=2 SV=1 112 448 2.0E-67
sp|Q54E41|HAOX_DICDI Hydroxyacid oxidase OS=Dictyostelium discoideum GN=haox PE=3 SV=1 119 448 6.0E-67
sp|Q9NYQ3|HAOX2_HUMAN Hydroxyacid oxidase 2 OS=Homo sapiens GN=HAO2 PE=1 SV=1 112 448 1.0E-64
sp|Q07523|HAOX2_RAT Hydroxyacid oxidase 2 OS=Rattus norvegicus GN=Hao2 PE=1 SV=2 112 448 4.0E-62
sp|Q9NYQ2|HAOX2_MOUSE Hydroxyacid oxidase 2 OS=Mus musculus GN=Hao2 PE=1 SV=1 112 448 4.0E-59
sp|O52792|HMO_AMYOR 4-hydroxymandelate oxidase OS=Amycolatopsis orientalis GN=hmo PE=1 SV=1 111 444 4.0E-57
sp|P20932|MDLB_PSEPU (S)-mandelate dehydrogenase OS=Pseudomonas putida GN=mdlB PE=1 SV=1 110 465 6.0E-50
sp|P9WND5|LLDD_MYCTU Putative L-lactate dehydrogenase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=lldD PE=1 SV=1 93 445 1.0E-49
sp|P9WND4|LLDD_MYCTO Putative L-lactate dehydrogenase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=lldD PE=3 SV=1 93 445 1.0E-49
sp|Q4ZY06|LLDD_PSEU2 L-lactate dehydrogenase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=lldD PE=3 SV=1 114 443 2.0E-46
sp|P21795|LA2M_MYCSM Lactate 2-monooxygenase OS=Mycobacterium smegmatis PE=1 SV=3 104 445 6.0E-46
sp|Q6DAY3|LLDD_PECAS L-lactate dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lldD PE=3 SV=1 101 446 1.0E-45
sp|O33655|LA2M_STRIN Lactate 2-monooxygenase OS=Streptococcus iniae GN=lctO PE=3 SV=1 111 444 2.0E-44
sp|Q3YVX0|LLDD_SHISS L-lactate dehydrogenase OS=Shigella sonnei (strain Ss046) GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|Q83PP7|LLDD_SHIFL L-lactate dehydrogenase OS=Shigella flexneri GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|Q0SYD1|LLDD_SHIF8 L-lactate dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|B6I3I4|LLDD_ECOSE L-lactate dehydrogenase OS=Escherichia coli (strain SE11) GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|B7M492|LLDD_ECO8A L-lactate dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|B5YWA7|LLDD_ECO5E L-lactate dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|Q8XDF7|LLDD_ECO57 L-lactate dehydrogenase OS=Escherichia coli O157:H7 GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|B7L725|LLDD_ECO55 L-lactate dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|A7ZTF9|LLDD_ECO24 L-lactate dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|Q329P9|LLDD_SHIDS L-lactate dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lldD PE=3 SV=1 114 446 3.0E-44
sp|B1LK44|LLDD_ECOSM L-lactate dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=lldD PE=3 SV=1 114 446 4.0E-44
sp|B2U5C2|LLDD_SHIB3 L-lactate dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lldD PE=3 SV=1 114 446 4.0E-44
sp|B7NER0|LLDD_ECOLU L-lactate dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=lldD PE=3 SV=1 114 446 4.0E-44
sp|P33232|LLDD_ECOLI L-lactate dehydrogenase OS=Escherichia coli (strain K12) GN=lldD PE=1 SV=1 114 446 4.0E-44
sp|B1IZI5|LLDD_ECOLC L-lactate dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=lldD PE=3 SV=1 114 446 4.0E-44
sp|A8A670|LLDD_ECOHS L-lactate dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=lldD PE=3 SV=1 114 446 4.0E-44
sp|B1X8M0|LLDD_ECODH L-lactate dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=lldD PE=3 SV=1 114 446 4.0E-44
sp|C4ZXJ7|LLDD_ECOBW L-lactate dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=lldD PE=3 SV=1 114 446 4.0E-44
sp|Q8FCB1|LLDD_ECOL6 L-lactate dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lldD PE=3 SV=1 114 446 5.0E-44
sp|Q0TBK1|LLDD_ECOL5 L-lactate dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=lldD PE=3 SV=1 114 446 5.0E-44
sp|B7NPB4|LLDD_ECO7I L-lactate dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=lldD PE=3 SV=1 114 446 5.0E-44
sp|B7ULG1|LLDD_ECO27 L-lactate dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=lldD PE=3 SV=1 114 446 5.0E-44
sp|Q1R4Z0|LLDD_ECOUT L-lactate dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=lldD PE=3 SV=1 114 446 5.0E-44
sp|B7MFG9|LLDD_ECO45 L-lactate dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=lldD PE=3 SV=1 114 446 5.0E-44
sp|B7N251|LLDD_ECO81 L-lactate dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=lldD PE=3 SV=1 114 446 8.0E-44
sp|Q31V17|LLDD_SHIBS L-lactate dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=lldD PE=3 SV=1 114 446 1.0E-43
sp|A1AHE2|LLDD_ECOK1 L-lactate dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=lldD PE=3 SV=1 114 446 1.0E-43
sp|B4SMK1|LLDD_STRM5 L-lactate dehydrogenase OS=Stenotrophomonas maltophilia (strain R551-3) GN=lldD PE=3 SV=1 101 449 2.0E-43
sp|C3K053|LLDD_PSEFS L-lactate dehydrogenase OS=Pseudomonas fluorescens (strain SBW25) GN=lldD PE=3 SV=2 101 443 2.0E-43
sp|A5UBE3|LLDD_HAEIE L-lactate dehydrogenase OS=Haemophilus influenzae (strain PittEE) GN=lldD PE=3 SV=1 133 449 4.0E-43
sp|P46454|LLDD_HAEIN L-lactate dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=lldD PE=3 SV=1 133 449 4.0E-43
sp|A5UFG9|LLDD_HAEIG L-lactate dehydrogenase OS=Haemophilus influenzae (strain PittGG) GN=lldD PE=3 SV=1 133 449 4.0E-43
sp|A7MNF6|LLDD_CROS8 L-lactate dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lldD PE=3 SV=1 101 443 5.0E-43
sp|Q4QJK8|LLDD_HAEI8 L-lactate dehydrogenase OS=Haemophilus influenzae (strain 86-028NP) GN=lldD PE=3 SV=1 133 449 6.0E-43
sp|Q6WB83|LLDD_ALCFA L-lactate dehydrogenase OS=Alcaligenes faecalis GN=lldD PE=3 SV=1 98 448 1.0E-42
sp|B2FIJ0|LLDD_STRMK L-lactate dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=lldD PE=3 SV=1 101 446 1.0E-42
sp|B5XMV0|LLDD_KLEP3 L-lactate dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=lldD PE=3 SV=1 101 446 2.0E-42
sp|B7LTL2|LLDD_ESCF3 L-lactate dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=lldD PE=3 SV=1 101 446 3.0E-42
sp|A6TFK0|LLDD_KLEP7 L-lactate dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=lldD PE=3 SV=1 101 446 7.0E-42
sp|B0KIT4|LLDD_PSEPG L-lactate dehydrogenase OS=Pseudomonas putida (strain GB-1) GN=lldD PE=3 SV=1 101 446 7.0E-42
sp|Q7VPI9|LLDD_HAEDU L-lactate dehydrogenase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=lldD PE=3 SV=1 133 449 8.0E-42
sp|Q87G18|LLDD_VIBPA L-lactate dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=lldD PE=3 SV=1 114 446 9.0E-42
sp|Q6FFS1|LLDD_ACIAD L-lactate dehydrogenase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=lldD PE=3 SV=1 99 440 2.0E-41
sp|Q8PE75|LLDD_XANCP L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=lldD PE=3 SV=1 96 446 3.0E-41
sp|Q4V0H2|LLDD_XANC8 L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=lldD PE=3 SV=1 96 446 3.0E-41
sp|A4XYG7|LLDD_PSEMY L-lactate dehydrogenase OS=Pseudomonas mendocina (strain ymp) GN=lldD PE=3 SV=1 101 448 3.0E-41
sp|Q88DT3|LLDD_PSEPK L-lactate dehydrogenase OS=Pseudomonas putida (strain KT2440) GN=lldD PE=3 SV=1 101 446 5.0E-41
sp|A5W9B2|LLDD_PSEP1 L-lactate dehydrogenase OS=Pseudomonas putida (strain F1 / ATCC 700007) GN=lldD PE=3 SV=1 101 446 5.0E-41
sp|Q3BZH2|LLDD_XANC5 L-lactate dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=lldD PE=3 SV=1 101 446 5.0E-41
sp|A8HTC9|LLDD_AZOC5 L-lactate dehydrogenase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=lldD PE=3 SV=1 91 446 5.0E-41
sp|B0RLM2|LLDD_XANCB L-lactate dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=lldD PE=3 SV=1 96 446 7.0E-41
sp|B1JPU0|LLDD_YERPY L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|Q66C32|LLDD_YERPS L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|A4TKI4|LLDD_YERPP L-lactate dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|Q1CGZ1|LLDD_YERPN L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|A9R623|LLDD_YERPG L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|Q8ZFV8|LLDD_YERPE L-lactate dehydrogenase OS=Yersinia pestis GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|B2JZQ1|LLDD_YERPB L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|Q1C9P0|LLDD_YERPA L-lactate dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|A7FJF0|LLDD_YERP3 L-lactate dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=lldD PE=3 SV=1 101 446 8.0E-41
sp|Q8PR33|LLDD_XANAC L-lactate dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=lldD PE=3 SV=1 96 446 1.0E-40
sp|Q1IF69|LLDD_PSEE4 L-lactate dehydrogenase OS=Pseudomonas entomophila (strain L48) GN=lldD PE=3 SV=1 101 446 1.0E-40
sp|B1J244|LLDD_PSEPW L-lactate dehydrogenase OS=Pseudomonas putida (strain W619) GN=lldD PE=3 SV=1 101 446 2.0E-40
sp|B0V6L1|LLDD_ACIBY L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AYE) GN=lldD PE=3 SV=1 101 446 2.0E-40
sp|A3M0X0|LLDD_ACIBT L-lactate dehydrogenase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=lldD PE=3 SV=2 101 446 2.0E-40
sp|B2I061|LLDD_ACIBC L-lactate dehydrogenase OS=Acinetobacter baumannii (strain ACICU) GN=lldD PE=3 SV=1 101 446 2.0E-40
sp|B7IBS4|LLDD_ACIB5 L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AB0057) GN=lldD PE=3 SV=1 101 446 2.0E-40
sp|B7H2H0|LLDD_ACIB3 L-lactate dehydrogenase OS=Acinetobacter baumannii (strain AB307-0294) GN=lldD PE=3 SV=1 101 446 2.0E-40
sp|B0VND0|LLDD_ACIBS L-lactate dehydrogenase OS=Acinetobacter baumannii (strain SDF) GN=lldD PE=3 SV=1 101 446 2.0E-40
sp|Q5H6Z4|LLDD_XANOR L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=lldD PE=3 SV=1 101 446 3.0E-40
sp|B2SUY3|LLDD_XANOP L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=lldD PE=3 SV=1 101 446 3.0E-40
sp|Q2P9K0|LLDD_XANOM L-lactate dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=lldD PE=3 SV=1 101 446 3.0E-40
sp|Q9HDX2|YKN3_SCHPO Uncharacterized lactate 2-monooxygenase PB1A11.03 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB1A11.03 PE=3 SV=1 155 441 3.0E-40
sp|C3LWP7|LLDD_VIBCM L-lactate dehydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=lldD PE=3 SV=1 140 446 6.0E-40
sp|Q9KKW6|LLDD_VIBCH L-lactate dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=lldD PE=3 SV=1 140 446 6.0E-40
sp|A8ARJ1|LLDD_CITK8 L-lactate dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lldD PE=3 SV=1 101 446 6.0E-40
sp|A7IMB0|LLDD_XANP2 L-lactate dehydrogenase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=lldD PE=3 SV=1 86 446 8.0E-40
sp|Q1R0J2|LLDD_CHRSD L-lactate dehydrogenase OS=Chromohalobacter salexigens (strain DSM 3043 / ATCC BAA-138 / NCIMB 13768) GN=lldD PE=3 SV=1 101 446 1.0E-39
sp|B0T7X2|LLDD_CAUSK L-lactate dehydrogenase OS=Caulobacter sp. (strain K31) GN=lldD PE=3 SV=1 99 443 1.0E-39
sp|A4W540|LLDD_ENT38 L-lactate dehydrogenase OS=Enterobacter sp. (strain 638) GN=lldD PE=3 SV=1 114 446 1.0E-39
sp|Q57ID8|LLDD_SALCH L-lactate dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=lldD PE=3 SV=1 101 446 2.0E-39
sp|C0Q1T7|LLDD_SALPC L-lactate dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=lldD PE=3 SV=1 101 446 2.0E-39
sp|B5RGI4|LLDD_SALG2 L-lactate dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=lldD PE=3 SV=1 101 446 3.0E-39
sp|B5R5C7|LLDD_SALEP L-lactate dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=lldD PE=3 SV=1 101 446 3.0E-39
sp|A6VCM8|LLDD_PSEA7 L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain PA7) GN=lldD PE=3 SV=1 101 446 3.0E-39
sp|B4T986|LLDD_SALHS L-lactate dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=lldD PE=3 SV=1 101 446 3.0E-39
sp|B5BHX7|LLDD_SALPK L-lactate dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=lldD PE=3 SV=1 101 446 4.0E-39
sp|Q5PLQ7|LLDD_SALPA L-lactate dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=lldD PE=3 SV=1 101 446 4.0E-39
sp|Q8ZL61|LLDD_SALTY L-lactate dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=lldD PE=3 SV=1 101 446 7.0E-39
sp|B5FLH2|LLDD_SALDC L-lactate dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=lldD PE=3 SV=1 101 446 7.0E-39
sp|B5EXA8|LLDD_SALA4 L-lactate dehydrogenase OS=Salmonella agona (strain SL483) GN=lldD PE=3 SV=1 101 446 7.0E-39
sp|A9MVJ5|LLDD_SALPB L-lactate dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=lldD PE=3 SV=1 101 446 7.0E-39
sp|A9MLC3|LLDD_SALAR L-lactate dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lldD PE=3 SV=1 101 446 8.0E-39
sp|Q8Z2E5|LLDD_SALTI L-lactate dehydrogenase OS=Salmonella typhi GN=lldD PE=3 SV=1 101 446 8.0E-39
sp|B4TZU7|LLDD_SALSV L-lactate dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=lldD PE=3 SV=1 101 446 8.0E-39
sp|Q9HV37|LLDD_PSEAE L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=lldD PE=3 SV=1 101 446 2.0E-38
sp|B7V1I3|LLDD_PSEA8 L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain LESB58) GN=lldD PE=3 SV=1 101 446 2.0E-38
sp|B9K115|LLDD_AGRVS L-lactate dehydrogenase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=lldD PE=3 SV=1 86 446 2.0E-38
sp|B0BTC7|LLDD_ACTPJ L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=lldD PE=3 SV=1 144 449 2.0E-38
sp|B3GZA5|LLDD_ACTP7 L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=lldD PE=3 SV=1 144 449 2.0E-38
sp|A3N3E5|LLDD_ACTP2 L-lactate dehydrogenase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=lldD PE=3 SV=1 144 449 2.0E-38
sp|Q02FQ1|LLDD_PSEAB L-lactate dehydrogenase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=lldD PE=3 SV=1 101 446 4.0E-38
sp|B4SXA4|LLDD_SALNS L-lactate dehydrogenase OS=Salmonella newport (strain SL254) GN=lldD PE=3 SV=1 101 446 4.0E-38
sp|A8GIL1|LLDD_SERP5 L-lactate dehydrogenase OS=Serratia proteamaculans (strain 568) GN=lldD PE=3 SV=1 101 446 1.0E-35
sp|Q6G4R2|LLDD_BARHE L-lactate dehydrogenase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=lldD PE=3 SV=1 98 454 2.0E-35
sp|A9IN89|LLDD_BART1 L-lactate dehydrogenase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=lldD PE=3 SV=1 99 443 1.0E-34
sp|Q9A943|LLDD_CAUCR L-lactate dehydrogenase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=lldD PE=3 SV=1 99 451 5.0E-34
sp|B8H3Q5|LLDD_CAUCN L-lactate dehydrogenase OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=lldD PE=3 SV=1 99 451 5.0E-34
sp|P9WND7|MFTD_MYCTU Putative mycofactocin system heme/flavin oxidoreductase MftD OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mftD PE=1 SV=1 145 462 8.0E-34
sp|P9WND6|MFTD_MYCTO Putative mycofactocin system heme/flavin oxidoreductase MftD OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mftD PE=3 SV=1 145 462 8.0E-34
sp|Q6G0J2|LLDD_BARQU L-lactate dehydrogenase OS=Bartonella quintana (strain Toulouse) GN=lldD PE=3 SV=1 99 443 1.0E-33
sp|Q9ZWT2|CYB5D_ARATH Cytochrome B5 isoform D OS=Arabidopsis thaliana GN=CYTB5-D PE=1 SV=1 7 85 2.0E-15
sp|Q9CQX2|CYB5B_MOUSE Cytochrome b5 type B OS=Mus musculus GN=Cyb5b PE=1 SV=1 6 61 4.0E-15
sp|Q9ZNV4|CYB5C_ARATH Cytochrome B5 isoform C OS=Arabidopsis thaliana GN=CYTB5-C PE=1 SV=1 7 83 8.0E-15
sp|P04166|CYB5B_RAT Cytochrome b5 type B OS=Rattus norvegicus GN=Cyb5b PE=1 SV=2 6 61 1.0E-14
sp|O04354|CYB5_BOROF Cytochrome b5 OS=Borago officinalis PE=2 SV=1 7 81 7.0E-14
sp|Q42342|CYB5E_ARATH Cytochrome b5 isoform E OS=Arabidopsis thaliana GN=CYTB5-E PE=1 SV=2 2 81 7.0E-14
sp|Q9V4N3|CYB5_DROME Cytochrome b5 OS=Drosophila melanogaster GN=Cyt-b5 PE=2 SV=1 7 64 9.0E-14
sp|P49099|CYB5S_TOBAC Cytochrome b5, seed isoform OS=Nicotiana tabacum PE=2 SV=1 7 81 1.0E-13
sp|O43169|CYB5B_HUMAN Cytochrome b5 type B OS=Homo sapiens GN=CYB5B PE=1 SV=2 6 91 2.0E-13
sp|P40934|CYB5_BRAOB Cytochrome b5 OS=Brassica oleracea var. botrytis GN=CYB5 PE=1 SV=1 2 81 2.0E-13
sp|P49100|CYB5_ORYSJ Cytochrome b5 OS=Oryza sativa subsp. japonica GN=Os05g0108800 PE=2 SV=2 6 81 2.0E-13
sp|P11035|NIA2_ARATH Nitrate reductase [NADH] 2 OS=Arabidopsis thaliana GN=NIA2 PE=1 SV=1 7 58 4.0E-13
sp|P27783|NIA_BETPN Nitrate reductase [NAD(P)H] OS=Betula pendula GN=NIA1 PE=2 SV=1 7 58 5.0E-13
sp|Q5RDJ5|CYB5B_PONAB Cytochrome b5 type B OS=Pongo abelii GN=CYB5B PE=2 SV=2 6 91 5.0E-13
sp|P00172|CYB5_PIG Cytochrome b5 OS=Sus scrofa GN=CYB5A PE=1 SV=3 6 61 6.0E-13
sp|P00171|CYB5_BOVIN Cytochrome b5 OS=Bos taurus GN=CYB5A PE=1 SV=3 6 61 6.0E-13
sp|P49098|CYB5_TOBAC Cytochrome b5 OS=Nicotiana tabacum PE=2 SV=1 7 81 6.0E-13
sp|P49096|CYB5_MUSDO Cytochrome b5 OS=Musca domestica GN=Cyt-b5 PE=1 SV=1 7 61 9.0E-13
sp|P00174|CYB5_CHICK Cytochrome b5 OS=Gallus gallus GN=CYB5A PE=1 SV=4 6 57 1.0E-12
sp|P43101|NIA_CICIN Nitrate reductase [NADH] OS=Cichorium intybus GN=NIA PE=2 SV=1 7 58 1.0E-12
sp|O48845|CYB5B_ARATH Cytochrome b5 isoform B OS=Arabidopsis thaliana GN=CYTB5-B PE=1 SV=1 7 81 2.0E-12
sp|P00168|CYB5_ALOSE Cytochrome b5 (Fragment) OS=Alouatta seniculus GN=CYB5A PE=1 SV=2 6 57 2.0E-12
sp|P39867|NIA1_BRANA Nitrate reductase [NADH], clone PBNBR1405 OS=Brassica napus GN=NIA1 PE=2 SV=1 7 58 2.0E-12
sp|Q874I5|CYB5_CANTR Cytochrome b5 OS=Candida tropicalis GN=Cytb5 PE=3 SV=1 6 69 2.0E-12
sp|P36859|NIA_PETHY Nitrate reductase [NADH] OS=Petunia hybrida GN=NIA PE=2 SV=1 7 58 2.0E-12
sp|P00169|CYB5_RABIT Cytochrome b5 OS=Oryctolagus cuniculus GN=CYB5A PE=1 SV=4 6 61 2.0E-12
sp|Q9HFV1|CYB5_RHIST Cytochrome b5 OS=Rhizopus stolonifer PE=2 SV=1 6 67 3.0E-12
sp|P00167|CYB5_HUMAN Cytochrome b5 OS=Homo sapiens GN=CYB5A PE=1 SV=2 6 61 3.0E-12
sp|P17569|NIA_CUCMA Nitrate reductase [NADH] OS=Cucurbita maxima PE=2 SV=1 7 58 3.0E-12
sp|P00170|CYB5_HORSE Cytochrome b5 OS=Equus caballus GN=CYB5A PE=1 SV=3 6 61 5.0E-12
sp|P56395|CYB5_MOUSE Cytochrome b5 OS=Mus musculus GN=Cyb5a PE=1 SV=2 6 57 6.0E-12
sp|P11832|NIA1_ARATH Nitrate reductase [NADH] 1 OS=Arabidopsis thaliana GN=NIA1 PE=1 SV=3 7 180 6.0E-12
sp|P00173|CYB5_RAT Cytochrome b5 OS=Rattus norvegicus GN=Cyb5a PE=1 SV=2 6 61 7.0E-12
sp|P39868|NIA2_BRANA Nitrate reductase [NADH], clone PBNBR1412 OS=Brassica napus GN=NIA2 PE=2 SV=1 7 58 8.0E-12
sp|P23312|NIA_SPIOL Nitrate reductase [NADH] OS=Spinacia oleracea GN=NIA PE=2 SV=1 7 58 8.0E-12
sp|P11605|NIA1_TOBAC Nitrate reductase [NADH] 1 OS=Nicotiana tabacum GN=NIA1 PE=3 SV=1 7 58 1.0E-11
sp|P08509|NIA2_TOBAC Nitrate reductase [NADH] 2 OS=Nicotiana tabacum GN=NIA2 PE=2 SV=2 7 58 1.0E-11
sp|Q9FDW8|CYB5A_ARATH Cytochrome b5 isoform A OS=Arabidopsis thaliana GN=CB5-A PE=1 SV=1 9 55 2.0E-11
sp|P39869|NIA_LOTJA Nitrate reductase [NADH] OS=Lotus japonicus GN=NIA PE=3 SV=1 7 58 2.0E-11
sp|P27967|NIA1_HORVU Nitrate reductase [NADH] OS=Hordeum vulgare PE=3 SV=1 7 58 2.0E-11
sp|P27969|NIA2_HORVU Nitrate reductase [NADH] (Fragment) OS=Hordeum vulgare PE=2 SV=1 7 58 2.0E-11
sp|Q10352|YDAA_SCHPO Uncharacterized protein C1F12.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F12.10c PE=3 SV=1 6 58 2.0E-11
sp|P17570|NIA_SOLLC Nitrate reductase [NADH] OS=Solanum lycopersicum GN=NIA PE=3 SV=1 7 58 3.0E-11
sp|P17571|NIA1_MAIZE Nitrate reductase [NADH] (Fragment) OS=Zea mays PE=1 SV=2 7 58 3.0E-11
sp|P39870|NIA2_SOYBN Inducible nitrate reductase [NADH] 2 OS=Glycine max GN=INR2 PE=2 SV=1 7 58 3.0E-11
sp|P39866|NIA2_PHAVU Nitrate reductase [NADH] 2 OS=Phaseolus vulgaris GN=NIA2 PE=3 SV=1 7 58 3.0E-11
sp|Q9P5L0|CYB5_NEUCR Probable cytochrome b5 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B23L21.190 PE=3 SV=2 7 57 6.0E-11
sp|P49097|CYB5_CUSRE Cytochrome b5 OS=Cuscuta reflexa PE=2 SV=1 7 102 7.0E-11
sp|P54233|NIA1_SOYBN Inducible nitrate reductase [NADH] 1 OS=Glycine max GN=INR1 PE=2 SV=1 7 58 7.0E-11
sp|P16081|NIA1_ORYSJ Nitrate reductase [NADH] 1 OS=Oryza sativa subsp. japonica GN=NIA1 PE=2 SV=3 7 58 7.0E-11
sp|P49102|NIA3_MAIZE Nitrate reductase [NADH] 3 OS=Zea mays PE=3 SV=1 7 58 7.0E-11
sp|Q9Y706|CYB5_MORAP Cytochrome b5 OS=Mortierella alpina PE=1 SV=1 7 57 1.0E-10
sp|O96099|FAD5B_DICDI Acyl-lipid (8-3)-desaturase B OS=Dictyostelium discoideum GN=fadB PE=1 SV=1 6 98 2.0E-10
sp|P27968|NIA7_HORVU Nitrate reductase [NAD(P)H] OS=Hordeum vulgare GN=NAR-7 PE=2 SV=1 7 58 2.0E-10
sp|Q9Y1W0|FAD5A_DICDI Delta(5) fatty acid desaturase A OS=Dictyostelium discoideum GN=fadA PE=1 SV=1 7 59 3.0E-10
sp|P36841|NIA_VOLCA Nitrate reductase [NADH] OS=Volvox carteri GN=NITA PE=2 SV=1 6 58 3.0E-10
sp|A9SIZ6|D5FAD_PHYPA Acyl-lipid (8-3)-desaturase OS=Physcomitrella patens subsp. patens GN=DES5 PE=1 SV=1 6 59 3.0E-10
sp|P40312|CYB5_YEAST Cytochrome b5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CYB5 PE=1 SV=2 7 84 4.0E-10
sp|P39865|NIA1_PHAVU Nitrate reductase [NADH] 1 OS=Phaseolus vulgaris GN=NIA1 PE=3 SV=1 7 58 4.0E-10
sp|P39864|NIA_PHYIN Nitrate reductase [NADPH] OS=Phytophthora infestans GN=NIAA PE=3 SV=1 5 58 5.0E-10
sp|O74875|YJ83_SCHPO Uncharacterized heme-binding protein C330.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC330.03c PE=1 SV=1 1 54 2.0E-09
sp|O22704|CYP5F_ARATH Cytochrome B5-like protein OS=Arabidopsis thaliana GN=CB5LP PE=2 SV=1 7 64 4.0E-09
sp|Q28CZ9|NB5R4_XENTR Cytochrome b5 reductase 4 OS=Xenopus tropicalis GN=cyb5r4 PE=2 SV=1 6 58 5.0E-09
sp|Q8DUI9|IDI2_STRMU Isopentenyl-diphosphate delta-isomerase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=fni PE=1 SV=1 301 444 6.0E-09
sp|O94391|CYB51_SCHPO Probable cytochrome b5 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC29A10.16c PE=3 SV=1 6 68 6.0E-09
sp|Q1ZXQ5|FAD5C_DICDI Probable Delta(5) fatty acid desaturase C OS=Dictyostelium discoideum GN=DDB_G0294553 PE=3 SV=1 7 103 1.0E-08
sp|P0DB81|IDI2_STRPQ Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=fni PE=3 SV=1 301 444 1.0E-08
sp|Q48U28|IDI2_STRPM Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=fni PE=3 SV=2 301 444 1.0E-08
sp|P65105|IDI2_STRP8 Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=fni PE=3 SV=1 301 444 1.0E-08
sp|Q5XCM6|IDI2_STRP6 Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=fni PE=3 SV=2 301 444 1.0E-08
sp|P0DB80|IDI2_STRP3 Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=fni PE=3 SV=1 301 444 1.0E-08
sp|P65103|IDI2_STRP1 Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pyogenes serotype M1 GN=fni PE=3 SV=1 301 444 1.0E-08
sp|Q8X0J4|CYB5L_NEUCR Putative cytochrome b5 B11H24.095 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=B11H24.095 PE=3 SV=1 8 66 1.0E-08
sp|Q9ZRP7|SLD1_ARATH Delta(8)-fatty-acid desaturase 1 OS=Arabidopsis thaliana GN=SLD1 PE=1 SV=1 3 59 1.0E-08
sp|P82291|CYB5_ECTSH Soluble cytochrome b558 OS=Ectothiorhodospira shaposhnikovii PE=1 SV=2 6 55 2.0E-08
sp|Q01170|NIA_CHLVU Nitrate reductase [NADH] (Fragment) OS=Chlorella vulgaris PE=2 SV=1 7 58 2.0E-08
sp|Q3EBF7|SLD2_ARATH Delta(8)-fatty-acid desaturase 2 OS=Arabidopsis thaliana GN=SLD2 PE=1 SV=1 3 59 3.0E-08
sp|Q7L1T6|NB5R4_HUMAN Cytochrome b5 reductase 4 OS=Homo sapiens GN=CYB5R4 PE=1 SV=1 6 58 4.0E-08
sp|P22945|NIA_EMENI Nitrate reductase [NADPH] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=niaD PE=3 SV=1 6 90 8.0E-08
sp|P39863|NIA_FUSOX Nitrate reductase [NADPH] OS=Fusarium oxysporum GN=NIA PE=3 SV=1 6 83 1.0E-07
sp|Q05531|NIA_USTMA Nitrate reductase [NADPH] OS=Ustilago maydis (strain 521 / FGSC 9021) GN=NAR1 PE=2 SV=2 7 115 1.0E-07
sp|Q3TDX8|NB5R4_MOUSE Cytochrome b5 reductase 4 OS=Mus musculus GN=Cyb5r4 PE=2 SV=3 6 58 1.0E-07
sp|Q32LH7|NB5R4_BOVIN Cytochrome b5 reductase 4 OS=Bos taurus GN=CYB5R4 PE=2 SV=1 6 58 1.0E-07
sp|Q03529|SCS7_YEAST Ceramide very long chain fatty acid hydroxylase SCS7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SCS7 PE=1 SV=1 8 52 2.0E-07
sp|P36858|NIA_ASPNG Nitrate reductase [NADPH] OS=Aspergillus niger GN=niaD PE=3 SV=1 7 90 2.0E-07
sp|Q9FR82|SLD1_BOROF Delta(8)-fatty-acid desaturase OS=Borago officinalis GN=sld1 PE=1 SV=1 7 59 2.0E-07
sp|Q502I6|NB5R4_DANRE Cytochrome b5 reductase 4 OS=Danio rerio GN=cyb5r4 PE=2 SV=1 6 58 2.0E-07
sp|Q43469|SLD1_HELAN Delta(8)-fatty-acid desaturase OS=Helianthus annuus GN=sld1 PE=1 SV=1 3 69 3.0E-07
sp|Q6DDK2|FADS2_XENLA Fatty acid desaturase 2 OS=Xenopus laevis GN=fads2 PE=2 SV=1 6 76 4.0E-07
sp|Q8CRB6|IDI2_STAES Isopentenyl-diphosphate delta-isomerase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=fni PE=3 SV=1 301 444 5.0E-07
sp|Q5HLP8|IDI2_STAEQ Isopentenyl-diphosphate delta-isomerase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=fni PE=3 SV=1 301 444 5.0E-07
sp|P08619|NIA_NEUCR Nitrate reductase [NADPH] OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nit-3 PE=1 SV=3 6 91 5.0E-07
sp|C1C5C3|IDI2_STRP7 Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pneumoniae (strain 70585) GN=fni PE=3 SV=1 131 444 5.0E-07
sp|Q68EJ0|NB5R4_RAT Cytochrome b5 reductase 4 OS=Rattus norvegicus GN=Cyb5r4 PE=1 SV=2 6 58 5.0E-07
sp|B2ILS5|IDI2_STRPS Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pneumoniae (strain CGSP14) GN=fni PE=1 SV=1 131 444 6.0E-07
sp|Q97SH8|IDI2_STRPN Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=fni PE=3 SV=1 131 444 6.0E-07
sp|B8ZLF5|IDI2_STRPJ Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pneumoniae (strain ATCC 700669 / Spain 23F-1) GN=fni PE=3 SV=1 131 444 6.0E-07
sp|Q8DR48|IDI2_STRR6 Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=fni PE=3 SV=1 301 444 6.0E-07
sp|Q04M86|IDI2_STRP2 Isopentenyl-diphosphate delta-isomerase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=fni PE=3 SV=1 301 444 6.0E-07
sp|A7Z638|IDI2_BACMF Isopentenyl-diphosphate delta-isomerase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=fni PE=3 SV=1 375 444 6.0E-07
sp|Q4R749|FADS2_MACFA Fatty acid desaturase 2 OS=Macaca fascicularis GN=FADS2 PE=2 SV=1 2 59 7.0E-07
sp|P36842|NIA_LEPMC Nitrate reductase [NADPH] OS=Leptosphaeria maculans GN=NIAD PE=3 SV=2 6 76 9.0E-07
sp|Q5REA7|FADS2_PONAB Fatty acid desaturase 2 OS=Pongo abelii GN=FADS2 PE=2 SV=1 2 59 1.0E-06
sp|Q9USM6|CYB52_SCHPO Probable cytochrome b5 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=oca8 PE=3 SV=1 6 57 1.0E-06
sp|O95864|FADS2_HUMAN Fatty acid desaturase 2 OS=Homo sapiens GN=FADS2 PE=1 SV=1 2 59 1.0E-06
sp|Q65I10|IDI2_BACLD Isopentenyl-diphosphate delta-isomerase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=fni PE=3 SV=1 309 457 1.0E-06
sp|A4UVI1|FADS1_PAPAN Fatty acid desaturase 1 OS=Papio anubis GN=FADS1 PE=1 SV=1 3 101 2.0E-06
sp|Q49ZS3|IDI2_STAS1 Isopentenyl-diphosphate delta-isomerase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=fni PE=3 SV=1 301 444 2.0E-06
sp|P43100|NIA_BEABA Nitrate reductase [NADPH] OS=Beauveria bassiana GN=NIA PE=3 SV=1 6 91 3.0E-06
sp|A4FV48|FADS2_BOVIN Fatty acid desaturase 2 OS=Bos taurus GN=FADS2 PE=2 SV=1 2 58 5.0E-06
sp|Q9DEX7|FADS2_DANRE Fatty acid desaturase 2 OS=Danio rerio GN=fads2 PE=2 SV=1 6 67 5.0E-06
sp|Q9LXD1|RLF_ARATH Cytochrome b5 domain-containing protein RLF OS=Arabidopsis thaliana GN=RLF PE=2 SV=1 6 69 6.0E-06
sp|O60427|FADS1_HUMAN Fatty acid desaturase 1 OS=Homo sapiens GN=FADS1 PE=1 SV=3 3 101 7.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0015930 glutamate synthase activity Yes
GO:0016638 oxidoreductase activity, acting on the CH-NH2 group of donors Yes
GO:0016491 oxidoreductase activity Yes
GO:0006537 glutamate biosynthetic process Yes
GO:0009064 glutamine family amino acid metabolic process No
GO:0006082 organic acid metabolic process No
GO:0009084 glutamine family amino acid biosynthetic process No
GO:0006536 glutamate metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0043436 oxoacid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0008152 metabolic process No
GO:0009058 biosynthetic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0043648 dicarboxylic acid metabolic process No
GO:0044238 primary metabolic process No
GO:0044237 cellular metabolic process No
GO:0046394 carboxylic acid biosynthetic process No
GO:0016053 organic acid biosynthetic process No
GO:0044249 cellular biosynthetic process No
GO:0003674 molecular_function No
GO:0006520 cellular amino acid metabolic process No
GO:1901564 organonitrogen compound metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0043650 dicarboxylic acid biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:1901607 alpha-amino acid biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:1901605 alpha-amino acid metabolic process No
GO:0008652 cellular amino acid biosynthetic process No
GO:0006807 nitrogen compound metabolic process No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1590
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|264
Ophiocordyceps australis map64 (Brazil) OphauB2|7297
Ophiocordyceps camponoti-floridani Ophcf2|04218
Ophiocordyceps camponoti-rufipedis Ophun1|6633 (this protein)
Ophiocordyceps kimflemingae Ophio5|2381
Ophiocordyceps subramaniannii Hirsu2|1215
Ophiocordyceps subramaniannii Hirsu2|8169

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6633
MALKGDDIAKHNSAESCWVIIHGKAYDVTDFLPEHPGGQNVILEHAGKDATEEFDPIHPPDTLDKYLDRSKHLGT
VDMDTVAVEASGSDDPDEMERREREAQKPLLSQCYNLFDFEAVARRVMKRTAWAYYSSASDDEIVSKSRQVLVDV
EKVHLGTTMLGTKCAAPFYVTATALGKLGHPEGEVVLTRAAHAHGVIQMIPTLASCSFDDIVDAKQGDQVQWLQL
YVNKDREITRSIVRHAEERGCKGLFITVDAPQLGRREKDMRTKFTDRGSNVQAGQTTDTSQGAARAISSFIDPSL
SWKDIAWFRSITKMPIVLKGVQRVDDVLRAIDAGVQGVVLSNHGGRQLDFSRSGIEILAEVMPVLRERGLDGRID
VLVDGGFRRASDILKALCLGAKGVGIGRPFLYAMSAYGQQGVERAMQLLKDEMEMDMRLLGCPTIEHLRPDLVDA
RGVFVHSNATPSDTLASTVYDPLIVPPQRPKAKL*
Coding >Ophun1|6633
ATGGCGCTGAAAGGCGACGACATCGCCAAGCACAACAGTGCTGAATCGTGCTGGGTTATCATCCATGGCAAAGCT
TACGACGTGACGGACTTCCTTCCAGAACACCCTGGTGGCCAAAACGTCATCCTCGAACACGCCGGAAAAGATGCG
ACAGAAGAGTTCGATCCGATTCACCCGCCGGACACGCTCGACAAGTACCTTGATCGGTCCAAGCACCTGGGAACC
GTCGACATGGACACTGTCGCCGTCGAGGCCAGCGGCTCTGATGACCCTGACGAGATGGAGCGACGGGAGCGCGAG
GCACAGAAGCCGTTGCTCTCGCAGTGTTATAACTTGTTTGACTTTGAGGCGGTGGCTCGCAGGGTCATGAAGCGC
ACCGCCTGGGCTTACTACTCGAGTGCCTCTGACGACGAGATTGTGAGCAAGTCTCGACAGGTGCTCGTCGACGTC
GAAAAGGTCCATCTCGGTACGACGATGCTGGGCACAAAATGCGCTGCGCCCTTCTACGTTACGGCTACGGCCCTC
GGCAAGCTGGGCCATCCGGAAGGCGAAGTGGTTTTGACGCGGGCCGCGCATGCTCACGGCGTGATACAGATGATT
CCCACGCTGGCCTCGTGCTCGTTTGACGACATCGTCGACGCCAAACAGGGTGACCAGGTGCAGTGGCTGCAACTG
TACGTCAACAAGGATCGCGAAATCACGCGCTCCATCGTTCGCCACGCCGAGGAGCGCGGCTGCAAGGGCCTCTTC
ATCACCGTCGACGCTCCGCAACTCGGCCGGCGCGAAAAGGACATGCGGACCAAGTTCACGGATCGTGGCAGTAAC
GTACAGGCCGGGCAGACGACTGATACCAGCCAAGGCGCGGCGCGGGCCATCTCGAGCTTCATCGACCCTTCGCTC
AGCTGGAAGGACATTGCTTGGTTCCGCAGCATCACCAAGATGCCAATCGTCCTCAAGGGTGTCCAGCGGGTCGAC
GACGTGCTGCGGGCCATCGACGCCGGCGTCCAGGGCGTCGTCTTGTCCAACCACGGCGGCCGCCAGCTCGACTTT
TCCCGCTCCGGCATCGAGATCCTGGCCGAGGTGATGCCCGTTCTGCGCGAACGCGGACTCGACGGCCGGATCGAC
GTTTTGGTCGACGGTGGCTTCCGGCGCGCCAGCGATATCCTCAAGGCGCTGTGTCTCGGCGCAAAGGGCGTCGGC
ATCGGTAGGCCCTTCTTGTACGCCATGAGCGCGTACGGCCAGCAGGGGGTCGAGCGCGCCATGCAGTTGCTCAAG
GACGAGATGGAGATGGACATGCGCCTCTTGGGCTGTCCTACCATCGAGCATCTTCGTCCCGATCTCGTCGACGCG
AGGGGCGTCTTTGTTCATTCCAATGCTACGCCTTCGGACACACTGGCTAGCACCGTCTATGATCCTCTCATTGTG
CCGCCGCAGAGGCCCAAGGCAAAACTCTAG
Transcript >Ophun1|6633
ATGGCGCTGAAAGGCGACGACATCGCCAAGCACAACAGTGCTGAATCGTGCTGGGTTATCATCCATGGCAAAGCT
TACGACGTGACGGACTTCCTTCCAGAACACCCTGGTGGCCAAAACGTCATCCTCGAACACGCCGGAAAAGATGCG
ACAGAAGAGTTCGATCCGATTCACCCGCCGGACACGCTCGACAAGTACCTTGATCGGTCCAAGCACCTGGGAACC
GTCGACATGGACACTGTCGCCGTCGAGGCCAGCGGCTCTGATGACCCTGACGAGATGGAGCGACGGGAGCGCGAG
GCACAGAAGCCGTTGCTCTCGCAGTGTTATAACTTGTTTGACTTTGAGGCGGTGGCTCGCAGGGTCATGAAGCGC
ACCGCCTGGGCTTACTACTCGAGTGCCTCTGACGACGAGATTGTGAGCAAGTCTCGACAGGTGCTCGTCGACGTC
GAAAAGGTCCATCTCGGTACGACGATGCTGGGCACAAAATGCGCTGCGCCCTTCTACGTTACGGCTACGGCCCTC
GGCAAGCTGGGCCATCCGGAAGGCGAAGTGGTTTTGACGCGGGCCGCGCATGCTCACGGCGTGATACAGATGATT
CCCACGCTGGCCTCGTGCTCGTTTGACGACATCGTCGACGCCAAACAGGGTGACCAGGTGCAGTGGCTGCAACTG
TACGTCAACAAGGATCGCGAAATCACGCGCTCCATCGTTCGCCACGCCGAGGAGCGCGGCTGCAAGGGCCTCTTC
ATCACCGTCGACGCTCCGCAACTCGGCCGGCGCGAAAAGGACATGCGGACCAAGTTCACGGATCGTGGCAGTAAC
GTACAGGCCGGGCAGACGACTGATACCAGCCAAGGCGCGGCGCGGGCCATCTCGAGCTTCATCGACCCTTCGCTC
AGCTGGAAGGACATTGCTTGGTTCCGCAGCATCACCAAGATGCCAATCGTCCTCAAGGGTGTCCAGCGGGTCGAC
GACGTGCTGCGGGCCATCGACGCCGGCGTCCAGGGCGTCGTCTTGTCCAACCACGGCGGCCGCCAGCTCGACTTT
TCCCGCTCCGGCATCGAGATCCTGGCCGAGGTGATGCCCGTTCTGCGCGAACGCGGACTCGACGGCCGGATCGAC
GTTTTGGTCGACGGTGGCTTCCGGCGCGCCAGCGATATCCTCAAGGCGCTGTGTCTCGGCGCAAAGGGCGTCGGC
ATCGGTAGGCCCTTCTTGTACGCCATGAGCGCGTACGGCCAGCAGGGGGTCGAGCGCGCCATGCAGTTGCTCAAG
GACGAGATGGAGATGGACATGCGCCTCTTGGGCTGTCCTACCATCGAGCATCTTCGTCCCGATCTCGTCGACGCG
AGGGGCGTCTTTGTTCATTCCAATGCTACGCCTTCGGACACACTGGCTAGCACCGTCTATGATCCTCTCATTGTG
CCGCCGCAGAGGCCCAAGGCAAAACTCTAG
Gene >Ophun1|6633
ATGGCGCTGAAAGGCGACGACATCGCCAAGCACAACAGTGCTGAATCGTGCTGGGTTATCATCCATGTAAGCGAA
AAGGACCCTTTCAAAGGCAAAAGGAACTGGCTGACGCCACCATTTGTTTCGACGCCACCGTAGGGCAAAGCTTAC
GACGTGACGGACTTCCTTCCAGGTCAATCGAGTCCTTGCAACGGTATTGGTCTCGCGTGACTGCTGACCGCGATG
CATCATCAGAACACCCTGGTGGCCAAAACGTCATCCTCGAACACGCCGTATGCACCATGTTTCCTCACCTCCAAC
GATCGATATTCTGATAGTCGAGGGTCTCCAGGGAAAAGATGCGACAGAAGAGTTCGATCCGATTCACCCGCCGGA
CACGCTCGACAAGTACCTTGATCGGTCCAAGCACCTGGGAACCGTCGACATGGACACTGTCGCCGTCGAGGCCAG
CGGCTCTGATGACCCTGACGAGATGGAGCGACGGGAGCGCGAGGCACAGAAGCCGTTGCTCTCGCAGTGTTATAA
CTTGTTTGACTTTGAGGCGGTGGCTCGCAGGGTCATGAAGCGCACCGCCTGGGCTTACTACTCGAGTGCCTCTGA
CGACGAGATTGTGAGCAAGTCTCGACAGGTGGGCGCGTGATATCCGCTGACGATGTCGAAGACGATGCGTGAGAA
TCACGCGGCTCTTCACAGGATATGGTTTCGTCCGCAGGTGCTCGTCGACGTCGAAAAGGTCCATCTCGGTACGAC
GATGCTGGGCACAAAATGCGCTGCGCCCTTCTACGTTACGGCTACGGCCCTCGGCAAGCTGGGCCATCCGGAAGG
CGAAGTGGTTTTGACGCGGGCCGCGCATGCTCACGGCGTGATACAGATGATTCCCACGCTGGCCTCGTGCTCGTT
TGACGACATCGTCGACGCCAAACAGGGTGACCAGGTGCAGTGGCTGCAACTGTACGTCAACAAGGATCGCGAAAT
CACGCGCTCCATCGTTCGCCACGCCGAGGAGCGCGGCTGCAAGGGCCTCTTCATCACCGTCGACGCTCCGCAACT
CGGCCGGCGCGAAAAGGACATGCGGACCAAGTTCACGGATCGTGGCAGTAACGTACAGGCCGGGCAGACGACTGA
TACCAGCCAAGGCGCGGCGCGGGCCATCTCGAGCTTCATCGACCCTTCGCTCAGCTGGAAGGACATTGCTTGGTT
CCGCAGCATCACCAAGATGCCAATCGTCCTCAAGGGTGTCCAGCGGGTCGACGACGTGCTGCGGGCCATCGACGC
CGGCGTCCAGGGCGTCGTCTTGTCCAACCACGGCGGCCGCCAGCTCGACTTTTCCCGCTCCGGCATCGAGATCCT
GGCCGAGGTGATGCCCGTTCTGCGCGAACGCGGACTCGACGGCCGGATCGACGTTTTGGTCGACGGTGGCTTCCG
GCGCGCCAGCGATATCCTCAAGGCGCTGTGTCTCGGCGCAAAGGGCGTCGGCATCGGTAGGCCCTTCTTGTACGC
CATGAGCGCGTACGGCCAGCAGGGGGTCGAGCGCGCCATGCAGTTGCTCAAGGACGAGATGGAGATGGACATGCG
CCTCTTGGGCTGTCCTACCATCGAGCATCTTCGTCCCGATCTCGTCGACGCGAGGGGCGTCTTTGTTCATTCCAA
TGCTACGCCTTCGGACACACTGGCTAGCACCGTCTATGATCCTCTCATTGTGCCGCCGCAGAGGCCCAAGGCAAA
ACTCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail