Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6632
Gene name
LocationContig_74:23027..30132
Strand+
Gene length (bp)7105
Transcript length (bp)5772
Coding sequence length (bp)5772
Protein length (aa) 1924

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03097 BRO1 BRO1-like domain 5.4E-128 934 1321
PF13949 ALIX_LYPXL_bnd ALIX V-shaped domain binding to HIV 2.5E-68 1362 1701
PF00614 PLDc Phospholipase D Active site motif 3.4E-07 175 200

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBS9|BRO1_GIBZE Vacuolar protein-sorting protein BRO1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BRO1 PE=3 SV=1 929 1923 0.0E+00
sp|Q7SAN9|BRO1_NEUCR Vacuolar protein-sorting protein bro-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bro-1 PE=3 SV=1 929 1923 0.0E+00
sp|C8V212|BRO1_EMENI Vacuolar protein-sorting protein bro1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=broA PE=3 SV=1 929 1923 0.0E+00
sp|Q4X0Z5|BRO1_ASPFU Vacuolar protein-sorting protein bro1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bro1 PE=3 SV=1 929 1923 0.0E+00
sp|P0CM44|BRO1_CRYNJ Vacuolar protein-sorting protein BRO1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BRO1 PE=3 SV=1 930 1827 5.0E-156
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4IBS9|BRO1_GIBZE Vacuolar protein-sorting protein BRO1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=BRO1 PE=3 SV=1 929 1923 0.0E+00
sp|Q7SAN9|BRO1_NEUCR Vacuolar protein-sorting protein bro-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=bro-1 PE=3 SV=1 929 1923 0.0E+00
sp|C8V212|BRO1_EMENI Vacuolar protein-sorting protein bro1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=broA PE=3 SV=1 929 1923 0.0E+00
sp|Q4X0Z5|BRO1_ASPFU Vacuolar protein-sorting protein bro1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=bro1 PE=3 SV=1 929 1923 0.0E+00
sp|P0CM44|BRO1_CRYNJ Vacuolar protein-sorting protein BRO1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=BRO1 PE=3 SV=1 930 1827 5.0E-156
sp|P0CM45|BRO1_CRYNB Vacuolar protein-sorting protein BRO1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=BRO1 PE=3 SV=1 930 1827 2.0E-155
sp|Q4PHA8|BRO1_USTMA Vacuolar protein-sorting protein BRO1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=BRO1 PE=3 SV=1 931 1710 6.0E-153
sp|Q6CGJ5|BRO1_YARLI Vacuolar protein-sorting protein BRO1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BRO1 PE=3 SV=1 934 1800 4.0E-104
sp|Q6BRL3|BRO1_DEBHA Vacuolar protein-sorting protein BRO1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=BRO1 PE=3 SV=2 934 1696 1.0E-85
sp|Q09706|PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pld1 PE=1 SV=1 67 491 1.0E-82
sp|P36126|SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO14 PE=1 SV=3 73 480 9.0E-82
sp|Q5AJC1|BRO1_CANAL Vacuolar protein-sorting protein BRO1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=BRO1 PE=3 SV=1 931 1752 4.0E-72
sp|Q8T7K0|ALIX_DICDI ALG-2 interacting protein X OS=Dictyostelium discoideum GN=alxA PE=1 SV=1 934 1856 5.0E-71
sp|Q0V8L6|PLD2_BOVIN Phospholipase D2 OS=Bos taurus GN=PLD2 PE=2 SV=1 71 484 3.0E-65
sp|P97813|PLD2_MOUSE Phospholipase D2 OS=Mus musculus GN=Pld2 PE=1 SV=2 71 484 1.0E-64
sp|O14939|PLD2_HUMAN Phospholipase D2 OS=Homo sapiens GN=PLD2 PE=1 SV=2 71 484 6.0E-64
sp|P70498|PLD2_RAT Phospholipase D2 OS=Rattus norvegicus GN=Pld2 PE=1 SV=2 71 484 5.0E-62
sp|O13783|BRO1_SCHPO Vacuolar protein-sorting protein bro1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bro1 PE=3 SV=1 932 1632 6.0E-59
sp|Q8WUM4|PDC6I_HUMAN Programmed cell death 6-interacting protein OS=Homo sapiens GN=PDCD6IP PE=1 SV=1 934 1711 8.0E-58
sp|Q9W6C5|PDC6I_XENLA Programmed cell death 6-interacting protein OS=Xenopus laevis GN=pdcd6ip PE=1 SV=1 934 1711 1.0E-57
sp|Q9WU78|PDC6I_MOUSE Programmed cell death 6-interacting protein OS=Mus musculus GN=Pdcd6ip PE=1 SV=3 939 1711 6.0E-57
sp|Q9QZA2|PDC6I_RAT Programmed cell death 6-interacting protein OS=Rattus norvegicus GN=Pdcd6ip PE=1 SV=2 939 1711 1.0E-56
sp|Q6PB44|PTN23_MOUSE Tyrosine-protein phosphatase non-receptor type 23 OS=Mus musculus GN=Ptpn23 PE=1 SV=2 927 1708 2.0E-53
sp|Q9H3S7|PTN23_HUMAN Tyrosine-protein phosphatase non-receptor type 23 OS=Homo sapiens GN=PTPN23 PE=1 SV=1 927 1786 3.0E-53
sp|Q54UK0|PLDA_DICDI Phospholipase D A OS=Dictyostelium discoideum GN=pldA PE=2 SV=1 79 486 7.0E-52
sp|Q6FJG8|BRO1_CANGA Vacuolar protein-sorting protein BRO1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=BRO1 PE=3 SV=1 934 1887 8.0E-51
sp|Q74ZJ6|BRO1_ASHGO Vacuolar protein-sorting protein BRO1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=BRO1 PE=3 SV=2 931 1751 3.0E-50
sp|P34552|ALXA_CAEEL Apoptosis-linked gene 2-interacting protein X 1 OS=Caenorhabditis elegans GN=alx-1 PE=2 SV=3 934 1710 1.0E-49
sp|P48582|BRO1_YEAST Vacuolar-sorting protein BRO1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BRO1 PE=1 SV=2 934 1685 6.0E-49
sp|P79020|PALA_EMENI pH-response regulator protein palA/RIM20 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=palA PE=1 SV=3 932 1860 5.0E-45
sp|Q6CM12|BRO1_KLULA Vacuolar protein-sorting protein BRO1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=BRO1 PE=3 SV=1 931 1687 3.0E-44
sp|Q9M9W8|PLDZ2_ARATH Phospholipase D zeta 2 OS=Arabidopsis thaliana GN=PLPZETA2 PE=1 SV=2 73 314 4.0E-42
sp|Q9LRZ5|PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana GN=PLDZETA1 PE=1 SV=1 70 285 8.0E-40
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1 220 483 5.0E-39
sp|Q5KU05|PALA_ASPOR pH-response regulator protein palA/RIM20 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=palA PE=3 SV=2 932 1747 2.0E-38
sp|Q51NJ3|PALA_MAGO7 pH-response regulator protein palA/RIM20 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIM20 PE=3 SV=1 939 1428 1.0E-36
sp|Q7S532|PALA_NEUCR pH-response regulator protein palA/prr-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=prr-1 PE=3 SV=2 929 1460 2.0E-36
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1 PE=1 SV=3 220 483 8.0E-36
sp|Q8TCX5|RHPN1_HUMAN Rhophilin-1 OS=Homo sapiens GN=RHPN1 PE=1 SV=1 933 1185 9.0E-36
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=PLD1 PE=2 SV=1 220 483 1.0E-35
sp|Q61085|RHPN1_MOUSE Rhophilin-1 OS=Mus musculus GN=Rhpn1 PE=1 SV=2 933 1184 5.0E-35
sp|Q8WZL4|PALA_YARLI pH-response regulator protein RIM20 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=RIM20 PE=3 SV=2 934 1709 4.0E-34
sp|Q63ZR5|RHN2B_XENLA Rhophilin-2-B OS=Xenopus laevis GN=rhpn2-b PE=2 SV=1 933 1181 5.0E-34
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE=2 SV=1 220 483 9.0E-34
sp|Q6DJJ6|RHN2A_XENLA Rhophilin-2-A OS=Xenopus laevis GN=rhpn2-a PE=2 SV=1 933 1180 3.0E-33
sp|Q8BWR8|RHPN2_MOUSE Rhophilin-2 OS=Mus musculus GN=Rhpn2 PE=1 SV=2 933 1179 4.0E-33
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN=PLD PE=3 SV=1 87 296 4.0E-32
sp|P0CM46|PALA_CRYNJ pH-response regulator protein palA/RIM20 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=RIM20 PE=3 SV=1 938 1457 7.0E-32
sp|P0CM47|PALA_CRYNB pH-response regulator protein palA/RIM20 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=RIM20 PE=3 SV=1 938 1457 7.0E-32
sp|A4FUC9|RHPN2_BOVIN Rhophilin-2 OS=Bos taurus GN=RHPN2 PE=2 SV=1 933 1179 8.0E-32
sp|Q8IUC4|RHPN2_HUMAN Rhophilin-2 OS=Homo sapiens GN=RHPN2 PE=1 SV=1 933 1180 6.0E-31
sp|Q8HXG3|RHPN2_CANLF Rhophilin-2 OS=Canis lupus familiaris GN=RHPN2 PE=2 SV=1 933 1179 8.0E-31
sp|Q54Z25|PLDC_DICDI Phospholipase D C OS=Dictyostelium discoideum GN=pldC PE=3 SV=1 72 294 9.0E-29
sp|Q6TNR1|RHPN2_DANRE Rhophilin-2 OS=Danio rerio GN=rhpn2 PE=2 SV=1 933 1181 2.0E-28
sp|Q12033|PALA_YEAST pH-response regulator protein palA/RIM20 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIM20 PE=1 SV=1 932 1348 2.0E-28
sp|Q6BLT2|PALA_DEBHA pH-response regulator protein palA/RIM20 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=RIM20 PE=3 SV=2 934 1705 6.0E-28
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1 59 211 1.0E-27
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE=2 SV=1 73 211 7.0E-27
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN=PLD PE=3 SV=1 303 480 9.0E-27
sp|P70498|PLD2_RAT Phospholipase D2 OS=Rattus norvegicus GN=Pld2 PE=1 SV=2 598 810 2.0E-26
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1 PE=1 SV=3 67 228 2.0E-26
sp|P97813|PLD2_MOUSE Phospholipase D2 OS=Mus musculus GN=Pld2 PE=1 SV=2 598 799 4.0E-26
sp|Q9LRZ5|PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana GN=PLDZETA1 PE=1 SV=1 336 493 5.0E-26
sp|O14939|PLD2_HUMAN Phospholipase D2 OS=Homo sapiens GN=PLD2 PE=1 SV=2 598 799 2.0E-25
sp|O88902|PTN23_RAT Tyrosine-protein phosphatase non-receptor type 23 (Fragment) OS=Rattus norvegicus GN=Ptpn23 PE=1 SV=2 1103 1708 6.0E-25
sp|Q0V8L6|PLD2_BOVIN Phospholipase D2 OS=Bos taurus GN=PLD2 PE=2 SV=1 598 796 8.0E-25
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 74 279 1.0E-24
sp|Q9M9W8|PLDZ2_ARATH Phospholipase D zeta 2 OS=Arabidopsis thaliana GN=PLPZETA2 PE=1 SV=2 341 493 2.0E-24
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=PLD1 PE=2 SV=1 73 211 2.0E-23
sp|Q13393|PLD1_HUMAN Phospholipase D1 OS=Homo sapiens GN=PLD1 PE=1 SV=1 586 799 2.0E-22
sp|Q9UW12|PALA_CANAL pH-response regulator protein palA/RIM20 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIM20 PE=3 SV=2 932 1705 2.0E-22
sp|O08684|PLD1_CRIGR Phospholipase D1 OS=Cricetulus griseus GN=PLD1 PE=2 SV=1 586 799 3.0E-22
sp|P70496|PLD1_RAT Phospholipase D1 OS=Rattus norvegicus GN=Pld1 PE=1 SV=3 586 799 4.0E-22
sp|A8MT19|RHN2P_HUMAN Putative rhophilin-2-like protein RHPN2P1 OS=Homo sapiens GN=RHPN2P1 PE=5 SV=2 933 1180 5.0E-22
sp|Q9M9W8|PLDZ2_ARATH Phospholipase D zeta 2 OS=Arabidopsis thaliana GN=PLPZETA2 PE=1 SV=2 601 798 7.0E-22
sp|Q9Z280|PLD1_MOUSE Phospholipase D1 OS=Mus musculus GN=Pld1 PE=2 SV=1 586 799 1.0E-21
sp|Q756C5|PALA_ASHGO pH-response regulator protein palA/RIM20 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RIM20 PE=3 SV=1 932 1321 2.0E-20
sp|Q5BMR2|PLD_PHYIN Phospholipase D OS=Phytophthora infestans GN=PLD PE=3 SV=1 600 751 2.0E-19
sp|Q09706|PLD1_SCHPO Phospholipase D1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pld1 PE=1 SV=1 598 675 2.0E-18
sp|Q43007|PLDA1_ORYSJ Phospholipase D alpha 1 OS=Oryza sativa subsp. japonica GN=PLD1 PE=1 SV=2 77 477 2.0E-18
sp|Q9LRZ5|PLDZ1_ARATH Phospholipase D zeta 1 OS=Arabidopsis thaliana GN=PLDZETA1 PE=1 SV=1 601 794 8.0E-18
sp|Q9T052|PLDG3_ARATH Phospholipase D gamma 3 OS=Arabidopsis thaliana GN=PLDGAMMA3 PE=1 SV=1 165 477 1.0E-17
sp|Q9T053|PLDG1_ARATH Phospholipase D gamma 1 OS=Arabidopsis thaliana GN=PLDGAMMA1 PE=1 SV=1 165 477 2.0E-17
sp|O82549|PLDA1_BRAOC Phospholipase D alpha 1 OS=Brassica oleracea var. capitata GN=PLD1 PE=2 SV=1 77 477 3.0E-17
sp|Q70EW5|PLDA1_CYNCA Phospholipase D alpha 1 OS=Cynara cardunculus GN=PLD1 PE=1 SV=2 154 477 4.0E-17
sp|Q9SSQ9|PLDA2_ARATH Phospholipase D alpha 2 OS=Arabidopsis thaliana GN=PLDALPHA2 PE=2 SV=1 77 477 5.0E-17
sp|P93400|PLDA1_TOBAC Phospholipase D alpha 1 OS=Nicotiana tabacum GN=PLD1 PE=2 SV=2 158 477 5.0E-17
sp|P93733|PLDB1_ARATH Phospholipase D beta 1 OS=Arabidopsis thaliana GN=PLDBETA1 PE=1 SV=4 175 477 6.0E-17
sp|Q43270|PLDA1_MAIZE Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 SV=1 77 477 9.0E-17
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 579 675 1.0E-16
sp|P36126|SPO14_YEAST Phospholipase D1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO14 PE=1 SV=3 584 674 2.0E-16
sp|Q9T051|PLDG2_ARATH Phospholipase D gamma 2 OS=Arabidopsis thaliana GN=PLDGAMMA2 PE=1 SV=3 165 477 5.0E-16
sp|P55939|PLDA2_BRAOC Phospholipase D alpha 2 OS=Brassica oleracea var. capitata GN=PLD2 PE=1 SV=2 103 477 6.0E-16
sp|Q38882|PLDA1_ARATH Phospholipase D alpha 1 OS=Arabidopsis thaliana GN=PLDALPHA1 PE=1 SV=2 158 477 6.0E-16
sp|Q54UK0|PLDA_DICDI Phospholipase D A OS=Dictyostelium discoideum GN=pldA PE=2 SV=1 586 677 8.0E-16
sp|Q41142|PLDA1_RICCO Phospholipase D alpha 1 OS=Ricinus communis GN=PLD1 PE=1 SV=1 158 477 8.0E-16
sp|Q54Z25|PLDC_DICDI Phospholipase D C OS=Dictyostelium discoideum GN=pldC PE=3 SV=1 592 798 1.0E-15
sp|Q54WR4|PLDB_DICDI Phospholipase D B OS=Dictyostelium discoideum GN=pldB PE=2 SV=1 328 481 1.0E-15
sp|P58766|PLDA3_ARATH Phospholipase D alpha 3 OS=Arabidopsis thaliana GN=PLDALPHA3 PE=2 SV=1 158 477 1.0E-14
sp|Q54Z25|PLDC_DICDI Phospholipase D C OS=Dictyostelium discoideum GN=pldC PE=3 SV=1 334 481 3.0E-14
sp|O04865|PLDA1_VIGUN Phospholipase D alpha 1 OS=Vigna unguiculata GN=PLD1 PE=2 SV=1 158 477 5.0E-14
sp|Q6CU63|PALA_KLULA pH-response regulator protein palA/RIM20 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=RIM20 PE=3 SV=1 992 1453 8.0E-14
sp|Q9C5Y0|PLDD1_ARATH Phospholipase D delta OS=Arabidopsis thaliana GN=PLDDELTA PE=1 SV=2 160 425 2.0E-12
sp|Q9C888|PLDA4_ARATH Phospholipase D alpha 4 OS=Arabidopsis thaliana GN=PLDALPHA4 PE=2 SV=1 92 450 3.0E-11
sp|Q09807|PALA_SCHPO pH-response regulator protein palA/rim20 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rim20 PE=3 SV=1 1034 1279 3.0E-07
sp|Q38882|PLDA1_ARATH Phospholipase D alpha 1 OS=Arabidopsis thaliana GN=PLDALPHA1 PE=1 SV=2 602 757 2.0E-06
sp|P93844|PLDA2_ORYSJ Phospholipase D alpha 2 OS=Oryza sativa subsp. japonica GN=PLD2 PE=2 SV=2 602 718 2.0E-06
sp|Q9SSQ9|PLDA2_ARATH Phospholipase D alpha 2 OS=Arabidopsis thaliana GN=PLDALPHA2 PE=2 SV=1 602 757 4.0E-06
sp|O04883|PLDA1_PIMBR Phospholipase D alpha 1 OS=Pimpinella brachycarpa GN=PLD1 PE=2 SV=1 602 735 4.0E-06
sp|O04865|PLDA1_VIGUN Phospholipase D alpha 1 OS=Vigna unguiculata GN=PLD1 PE=2 SV=1 602 757 7.0E-06
sp|Q43007|PLDA1_ORYSJ Phospholipase D alpha 1 OS=Oryza sativa subsp. japonica GN=PLD1 PE=1 SV=2 602 688 9.0E-06
sp|Q43270|PLDA1_MAIZE Phospholipase D alpha 1 OS=Zea mays GN=PLD1 PE=2 SV=1 602 757 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003824 catalytic activity Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5114
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|805
Ophiocordyceps australis map64 (Brazil) OphauB2|7301
Ophiocordyceps camponoti-floridani Ophcf2|04220
Ophiocordyceps camponoti-rufipedis Ophun1|6632 (this protein)
Ophiocordyceps kimflemingae Ophio5|2384
Ophiocordyceps subramaniannii Hirsu2|3314

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6632
MSESKDDQGSFSSFVDDLKDKLHDSKLHDAKVHLTHKKHQIGKLGNLFNRDHRHDEEHEQRCDEKRTKTCETHRY
ESFFPERDGNLVKWYVDGRDYFWAVSVALEEAQETIYIADWWLSPELFLRRPPRGXTSRHTKNALQSLCPEGTPG
YGNIRVVRHPDHNVFENAADMTMYWAHHEKFIVIDYYLAFIGGLDLCFGRWDARQHPLSDVHPEGVSEEIWPGQD
FNNNRIMDFKKVEDWQQNELSKAEFGRMPWHDVAMALIGPCVYDIAEHFVLRWNFIKRDKHKRDERHDWLVLEGR
EGDDEDLVGVQRPKHPVGEYVKHPLTPLASKNLENRGTIHAQVVRSSADWSSGILNDHSIQNAYCEVIRKAEHYV
YIENQFFITATGDQQPPIHNTIGAAMVDAVVRAAKEGRKFRIIVILPAIPGFAGDLRENAASGTRAIMDYQYKSI
CRGEHSIFGRIKAQGVDPNQHIFFFNLRSYDRLNKTNAITVAEKKTGISYQQVQRAEAEEIMAEGVYGYEDDSSD
DGRRSKRHEKTNAQRGPSENVIKAREVFDEAKPDEEVVSAASVAHHALAGQGSLKDEPWDTHADPESEIRNWIQE
ELYVHAKLVIADDRVVICGSSNINDRSQLGDHDSELSIVMEDTRMIPSTMDGQPFEAGWHAATLRRFLWREHLGL
LPPQDLDAADDINAQPPTVNPENNIYDDIDSYKFVEDPLGDDLWSMWTGQADKNTGLFRHLFHADPDDKIKTFED
YDRYLPPKGVKSGHIYDQFMPPEEARDKLDQIKGHLVWMPMAFLEDAEMAERGLQVNAWTESRAAAPRTFVGGEA
ASQAPRWGQSGGELETACAGHSCLAVLLSMGFVETLPWTAPDITLGPHKRSPTQRSAVARRRRQLLGGQLRAAPA
AVAVAAACDRPAVVIAVGLRPRPVAQDTMTQSPMISAPIKATNEIDWVGPLKTYIRDTYGDDPERYAEECATLNR
LRQNMRGAGKDSIPGRDILYRYYGQLELLDLRFPVDEQHIKISFTWFDAFTHKPTTQYSLAFEKASVIFNISAVL
SCHGALQNRADDPALKTAYHSFQASAGMFTYINDNFLHAPSFDLSRECVKALIQVMLAQAQEIFLEKQVADQKKI
GLLAKLASQTAYLYGQAVEGVQENVNKAVFEKVWLTLVQVKTSLFNSKAQYYQALADAEGGEHGAAVSRLRVAEA
LAKEAERTSRTLPATLPAGCNLSAETSGILQELSKRQYATVQEKLIEEVKDNDFVYHQTVPPEPSLPPIPKLPAA
KPIPVSELYAGQDISRITGPDLFSKIVPLAVTESASLYDEEKAKLVRAETEKADMANGEMAAALDYLRLPGALQV
LKGGFDQELLPDEDFKQWCDDVADHENPNAILEWLRSEKESIVSILDRSGKQLDMEESVCEKMRSKYDGEWSQQP
SARLTTTLRGDIRSYREALEEAMASDSQLDAKLRQSAGEFDEMRRAAQNGEVDGLYQRAVAAAKGKAGSVSTSAP
DPEPNLLDADFGEGESSVADQVARVEDLLKKLNLVKRERNQVLKDLKEKVSLSVRDWARMSEILKERLKVHNDDI
SQVLILNKKSISNYETQLFEQELGKFRPHQNRLLQANHKQSALMKELTTLYNALLQDKRVRNERTKYEAIQRQTS
AVVNRYKRAYQEFLDLEAGLQSAKNWYAEMRETAESLEKNVETFVNNRRSEGAQLLNQIEQDRSVSKNSQAELER
ERLRGLMERMSMEPAKSPPRPASGRPTPAPLPLSQTGPGPARYPQTNYQGHYQVPTSPPPNNAGHMQQQVHHQQH
QHSAYGGYSSPAGAAGGFSPPTYNPSQYGPTAGPRSPPPTQTSFGPGARAPQPYQSYGGPQGPGTAMPPGFVPPP
PPPGPPPLGPQQTIHYGNQEYEVPQGTQSGPSQGQQPHDPWAGLSAWK*
Coding >Ophun1|6632
ATGTCGGAGTCAAAGGACGATCAGGGCAGCTTCTCGTCCTTCGTCGACGACCTCAAGGACAAGCTTCACGATAGT
AAGCTTCACGACGCAAAGGTCCATCTCACTCATAAAAAGCACCAGATTGGAAAGCTGGGCAACCTGTTCAACAGA
GACCACCGCCACGATGAAGAGCACGAGCAGAGATGCGACGAAAAGAGGACCAAGACATGCGAAACCCACCGCTAC
GAGTCATTTTTCCCCGAACGAGACGGGAACCTCGTCAAGTGGTACGTCGACGGTCGCGACTACTTCTGGGCCGTT
TCGGTGGCTCTAGAAGAGGCTCAAGAGACCATCTACATTGCCGACTGGTGGCTTTCGCCCGAGCTCTTTCTCCGA
CGTCCGCCGCGGGGGNNCACCTCCCGCCATACCAAGAATGCGCTGCAGTCTCTTTGTCCCGAGGGCACGCCGGGT
TACGGCAACATCCGCGTGGTGCGACACCCGGACCACAACGTCTTCGAGAACGCTGCCGACATGACCATGTACTGG
GCCCATCACGAAAAGTTCATTGTCATCGACTACTACCTGGCCTTCATCGGCGGGCTTGATCTCTGCTTTGGCCGC
TGGGATGCTCGGCAGCACCCTCTCTCCGACGTCCATCCCGAGGGCGTCTCGGAGGAGATATGGCCAGGCCAGGAC
TTCAACAACAACCGTATCATGGACTTCAAAAAGGTCGAGGATTGGCAGCAGAACGAACTTAGCAAGGCCGAGTTT
GGCCGCATGCCATGGCATGACGTAGCCATGGCGCTCATCGGCCCCTGCGTTTACGACATCGCCGAGCACTTCGTC
CTGCGTTGGAACTTTATCAAGCGGGACAAGCACAAGCGCGACGAGCGTCATGACTGGCTGGTCCTCGAGGGCCGC
GAAGGAGATGACGAGGACCTGGTCGGCGTTCAGCGACCCAAGCACCCTGTCGGAGAATACGTCAAGCATCCCCTG
ACGCCCCTCGCCTCCAAGAACCTCGAGAACCGGGGCACGATCCACGCCCAAGTCGTTCGCTCGAGCGCCGACTGG
TCCAGCGGGATTCTCAATGACCATTCCATTCAGAACGCCTACTGCGAGGTCATCCGGAAAGCAGAGCACTACGTC
TATATCGAGAATCAATTCTTCATCACTGCCACGGGCGACCAGCAGCCTCCCATCCACAACACCATCGGCGCGGCC
ATGGTGGACGCCGTTGTGCGAGCGGCTAAGGAGGGCCGCAAATTTCGTATCATCGTCATCCTCCCGGCGATACCG
GGCTTCGCTGGTGACCTGCGGGAAAACGCGGCTTCGGGCACTCGAGCCATCATGGACTATCAATACAAGTCGATA
TGTCGCGGCGAGCACTCCATCTTTGGCCGCATCAAGGCTCAGGGCGTCGACCCGAATCAGCACATCTTCTTCTTC
AATCTCCGTTCCTACGACCGCCTCAACAAGACAAATGCCATTACTGTTGCAGAGAAGAAGACTGGGATCAGCTAC
CAACAGGTGCAACGAGCCGAGGCGGAAGAGATCATGGCTGAGGGCGTTTACGGGTACGAAGACGACAGCTCCGAT
GACGGCAGGCGGTCGAAGCGCCACGAAAAGACCAATGCACAAAGGGGGCCATCGGAGAACGTGATTAAGGCGAGA
GAGGTATTCGACGAGGCAAAGCCTGATGAGGAAGTAGTATCGGCCGCATCCGTTGCCCACCACGCTCTGGCCGGT
CAGGGCTCTCTCAAGGACGAGCCATGGGATACCCACGCAGATCCAGAGTCTGAGATACGGAACTGGATCCAAGAA
GAGCTCTACGTCCACGCGAAGCTTGTCATTGCTGACGATCGGGTCGTCATCTGCGGTTCAAGCAATATCAACGAC
CGCAGCCAGCTGGGAGACCACGACAGCGAGCTCAGCATTGTCATGGAAGACACAAGGATGATTCCAAGCACAATG
GATGGACAGCCGTTCGAGGCCGGCTGGCATGCTGCCACGTTGCGCCGCTTCCTGTGGCGCGAGCATCTGGGCCTC
CTCCCGCCGCAGGACCTGGATGCCGCCGACGACATCAATGCGCAGCCTCCCACGGTGAATCCGGAAAACAACATA
TACGACGACATCGATAGCTACAAGTTTGTCGAGGATCCTTTGGGTGACGACCTGTGGTCCATGTGGACCGGGCAG
GCAGACAAGAACACGGGCTTGTTCCGGCACCTATTCCACGCGGACCCGGACGACAAGATCAAAACGTTTGAGGAC
TACGACCGATATCTCCCGCCCAAGGGTGTCAAGTCGGGTCACATCTACGATCAGTTCATGCCGCCCGAAGAGGCA
CGGGATAAGCTCGATCAGATCAAGGGACACTTGGTGTGGATGCCCATGGCGTTCCTGGAAGACGCTGAGATGGCG
GAACGGGGGTTGCAGGTCAACGCTTGGACGGAAAGCCGAGCCGCCGCGCCACGGACGTTCGTCGGAGGTGAAGCG
GCGTCGCAAGCGCCGAGATGGGGCCAATCGGGAGGGGAGCTGGAGACGGCGTGCGCAGGCCACAGCTGCCTGGCT
GTGCTGCTGAGCATGGGATTCGTTGAGACTCTGCCGTGGACTGCTCCGGATATCACGCTCGGGCCGCATAAGAGG
TCGCCGACGCAGCGCTCTGCCGTCGCTCGCCGTCGACGGCAGCTGCTCGGGGGTCAGCTCAGAGCGGCTCCAGCT
GCCGTCGCCGTCGCCGCTGCGTGCGACCGGCCGGCTGTCGTGATCGCCGTCGGCCTACGACCTCGTCCCGTCGCA
CAAGACACCATGACGCAGTCGCCCATGATCTCGGCGCCAATCAAGGCGACTAACGAGATCGACTGGGTCGGTCCT
CTCAAGACCTACATCCGCGACACGTATGGCGACGATCCCGAACGATACGCCGAGGAGTGTGCCACCCTCAACCGT
CTGAGGCAGAACATGCGCGGGGCGGGAAAGGACAGCATCCCCGGCCGCGACATCCTCTACCGCTACTACGGTCAA
CTAGAGCTCCTTGACCTGCGCTTCCCCGTCGATGAACAGCACATCAAGATATCATTCACCTGGTTCGATGCCTTC
ACCCACAAGCCCACCACCCAATACTCGCTCGCGTTCGAAAAGGCCTCCGTCATCTTCAACATCTCCGCCGTTCTG
TCCTGCCATGGAGCCCTGCAGAACCGCGCCGACGATCCGGCCCTCAAGACGGCCTATCACTCGTTCCAGGCTTCT
GCCGGCATGTTCACCTACATCAACGACAACTTTCTCCATGCCCCGTCCTTCGACCTGAGCCGAGAGTGTGTCAAG
GCCCTGATTCAGGTCATGCTCGCGCAAGCTCAAGAGATATTCCTCGAGAAGCAGGTGGCTGATCAGAAGAAGATT
GGCTTGCTGGCCAAGCTGGCCTCGCAAACCGCTTATCTCTACGGTCAAGCCGTTGAAGGTGTTCAGGAAAACGTC
AACAAGGCCGTGTTTGAGAAGGTGTGGTTGACGCTGGTCCAGGTGAAGACGAGTCTCTTCAACTCGAAAGCCCAG
TATTACCAGGCGCTGGCCGACGCCGAAGGAGGAGAACATGGAGCCGCCGTCTCGCGCCTCCGTGTCGCCGAGGCC
CTGGCAAAAGAAGCCGAACGCACGTCGAGAACCTTGCCGGCTACCCTTCCGGCGGGCTGCAATCTAAGCGCCGAA
ACGAGCGGGATCTTGCAAGAGCTTTCAAAGCGGCAGTACGCCACCGTGCAGGAAAAGCTGATCGAGGAGGTCAAG
GACAATGACTTTGTCTACCACCAAACCGTTCCACCAGAGCCCAGCCTGCCGCCCATTCCCAAGCTGCCCGCGGCC
AAGCCGATACCAGTCAGTGAGCTGTACGCGGGTCAGGACATCTCGCGCATCACGGGGCCCGACCTGTTTTCCAAA
ATCGTCCCCTTGGCCGTAACGGAGTCGGCGAGTCTGTACGACGAGGAGAAGGCGAAGCTAGTGAGGGCCGAGACG
GAGAAAGCAGATATGGCCAATGGGGAGATGGCGGCCGCTCTTGACTATCTGCGGCTTCCCGGGGCGTTGCAAGTC
CTCAAGGGGGGGTTCGATCAAGAACTTCTCCCGGACGAGGACTTTAAGCAGTGGTGTGACGACGTTGCTGACCAC
GAGAACCCGAACGCTATTCTCGAGTGGCTGAGGTCGGAGAAGGAGTCGATCGTGTCTATTCTCGACAGGAGTGGG
AAGCAGCTCGACATGGAGGAGAGCGTGTGCGAGAAGATGCGGTCGAAATATGATGGCGAATGGAGCCAGCAACCG
AGCGCTCGACTAACGACGACGCTCCGAGGAGACATCCGCAGTTACCGAGAGGCGCTGGAAGAGGCCATGGCGAGC
GACAGCCAGCTGGATGCGAAGCTGCGCCAGAGCGCCGGGGAGTTTGACGAGATGCGACGGGCAGCCCAGAACGGC
GAGGTAGACGGGCTCTACCAGAGAGCCGTGGCGGCGGCCAAAGGCAAGGCTGGAAGCGTCTCGACGAGCGCGCCC
GACCCCGAGCCCAACCTGCTGGACGCCGACTTTGGCGAGGGCGAATCGAGCGTGGCCGACCAGGTGGCGAGGGTC
GAGGATTTGCTCAAGAAGCTGAATCTGGTGAAGAGGGAGCGGAATCAAGTGCTCAAGGATTTGAAGGAAAAGGTG
AGTCTTTCGGTCCGCGACTGGGCGAGGATGAGCGAGATACTAAAGGAGCGTTTGAAGGTCCACAACGACGATATT
TCACAGGTTCTGATTCTCAATAAAAAGTCTATTTCCAACTACGAGACCCAGCTGTTCGAGCAGGAGCTCGGGAAA
TTCCGGCCGCACCAGAATCGGCTGCTGCAGGCAAACCACAAGCAGTCAGCCCTGATGAAGGAATTGACGACTCTC
TACAACGCGCTGCTTCAGGACAAGCGGGTGCGGAATGAGCGCACGAAATACGAGGCCATCCAGCGGCAGACGTCG
GCGGTGGTCAACAGATACAAGCGAGCATATCAGGAGTTTCTCGACCTCGAGGCCGGTCTTCAGAGCGCGAAAAAC
TGGTACGCAGAGATGAGGGAGACAGCTGAGAGCCTTGAGAAGAACGTGGAGACGTTTGTCAACAACCGGAGGTCG
GAAGGCGCTCAGCTGCTTAACCAGATCGAACAGGATCGGTCGGTGAGCAAGAACAGCCAGGCGGAACTGGAGCGG
GAGCGGCTACGGGGTCTTATGGAGCGCATGTCGATGGAACCGGCCAAGTCGCCGCCGCGGCCGGCTTCCGGGCGG
CCGACGCCGGCCCCGCTGCCGCTGTCTCAGACGGGCCCGGGGCCGGCCCGGTATCCGCAGACAAACTATCAGGGC
CACTACCAGGTGCCGACGTCGCCGCCGCCCAACAACGCGGGCCACATGCAGCAGCAGGTTCATCACCAGCAACAT
CAGCACTCAGCCTATGGCGGCTATAGCAGCCCAGCCGGCGCGGCTGGCGGCTTCTCGCCGCCGACGTACAACCCA
AGCCAATATGGCCCGACGGCAGGGCCCCGTTCGCCGCCGCCGACACAGACATCCTTTGGGCCGGGAGCGCGTGCT
CCACAGCCCTACCAGTCTTACGGAGGGCCCCAGGGGCCGGGTACCGCCATGCCGCCAGGTTTCGTACCGCCACCG
CCGCCTCCAGGACCGCCGCCGTTGGGGCCGCAGCAGACCATACACTACGGGAACCAAGAGTATGAGGTGCCTCAG
GGCACACAGTCGGGGCCGTCGCAAGGCCAACAGCCCCACGATCCATGGGCGGGACTCAGCGCGTGGAAATAG
Transcript >Ophun1|6632
ATGTCGGAGTCAAAGGACGATCAGGGCAGCTTCTCGTCCTTCGTCGACGACCTCAAGGACAAGCTTCACGATAGT
AAGCTTCACGACGCAAAGGTCCATCTCACTCATAAAAAGCACCAGATTGGAAAGCTGGGCAACCTGTTCAACAGA
GACCACCGCCACGATGAAGAGCACGAGCAGAGATGCGACGAAAAGAGGACCAAGACATGCGAAACCCACCGCTAC
GAGTCATTTTTCCCCGAACGAGACGGGAACCTCGTCAAGTGGTACGTCGACGGTCGCGACTACTTCTGGGCCGTT
TCGGTGGCTCTAGAAGAGGCTCAAGAGACCATCTACATTGCCGACTGGTGGCTTTCGCCCGAGCTCTTTCTCCGA
CGTCCGCCGCGGGGGNNCACCTCCCGCCATACCAAGAATGCGCTGCAGTCTCTTTGTCCCGAGGGCACGCCGGGT
TACGGCAACATCCGCGTGGTGCGACACCCGGACCACAACGTCTTCGAGAACGCTGCCGACATGACCATGTACTGG
GCCCATCACGAAAAGTTCATTGTCATCGACTACTACCTGGCCTTCATCGGCGGGCTTGATCTCTGCTTTGGCCGC
TGGGATGCTCGGCAGCACCCTCTCTCCGACGTCCATCCCGAGGGCGTCTCGGAGGAGATATGGCCAGGCCAGGAC
TTCAACAACAACCGTATCATGGACTTCAAAAAGGTCGAGGATTGGCAGCAGAACGAACTTAGCAAGGCCGAGTTT
GGCCGCATGCCATGGCATGACGTAGCCATGGCGCTCATCGGCCCCTGCGTTTACGACATCGCCGAGCACTTCGTC
CTGCGTTGGAACTTTATCAAGCGGGACAAGCACAAGCGCGACGAGCGTCATGACTGGCTGGTCCTCGAGGGCCGC
GAAGGAGATGACGAGGACCTGGTCGGCGTTCAGCGACCCAAGCACCCTGTCGGAGAATACGTCAAGCATCCCCTG
ACGCCCCTCGCCTCCAAGAACCTCGAGAACCGGGGCACGATCCACGCCCAAGTCGTTCGCTCGAGCGCCGACTGG
TCCAGCGGGATTCTCAATGACCATTCCATTCAGAACGCCTACTGCGAGGTCATCCGGAAAGCAGAGCACTACGTC
TATATCGAGAATCAATTCTTCATCACTGCCACGGGCGACCAGCAGCCTCCCATCCACAACACCATCGGCGCGGCC
ATGGTGGACGCCGTTGTGCGAGCGGCTAAGGAGGGCCGCAAATTTCGTATCATCGTCATCCTCCCGGCGATACCG
GGCTTCGCTGGTGACCTGCGGGAAAACGCGGCTTCGGGCACTCGAGCCATCATGGACTATCAATACAAGTCGATA
TGTCGCGGCGAGCACTCCATCTTTGGCCGCATCAAGGCTCAGGGCGTCGACCCGAATCAGCACATCTTCTTCTTC
AATCTCCGTTCCTACGACCGCCTCAACAAGACAAATGCCATTACTGTTGCAGAGAAGAAGACTGGGATCAGCTAC
CAACAGGTGCAACGAGCCGAGGCGGAAGAGATCATGGCTGAGGGCGTTTACGGGTACGAAGACGACAGCTCCGAT
GACGGCAGGCGGTCGAAGCGCCACGAAAAGACCAATGCACAAAGGGGGCCATCGGAGAACGTGATTAAGGCGAGA
GAGGTATTCGACGAGGCAAAGCCTGATGAGGAAGTAGTATCGGCCGCATCCGTTGCCCACCACGCTCTGGCCGGT
CAGGGCTCTCTCAAGGACGAGCCATGGGATACCCACGCAGATCCAGAGTCTGAGATACGGAACTGGATCCAAGAA
GAGCTCTACGTCCACGCGAAGCTTGTCATTGCTGACGATCGGGTCGTCATCTGCGGTTCAAGCAATATCAACGAC
CGCAGCCAGCTGGGAGACCACGACAGCGAGCTCAGCATTGTCATGGAAGACACAAGGATGATTCCAAGCACAATG
GATGGACAGCCGTTCGAGGCCGGCTGGCATGCTGCCACGTTGCGCCGCTTCCTGTGGCGCGAGCATCTGGGCCTC
CTCCCGCCGCAGGACCTGGATGCCGCCGACGACATCAATGCGCAGCCTCCCACGGTGAATCCGGAAAACAACATA
TACGACGACATCGATAGCTACAAGTTTGTCGAGGATCCTTTGGGTGACGACCTGTGGTCCATGTGGACCGGGCAG
GCAGACAAGAACACGGGCTTGTTCCGGCACCTATTCCACGCGGACCCGGACGACAAGATCAAAACGTTTGAGGAC
TACGACCGATATCTCCCGCCCAAGGGTGTCAAGTCGGGTCACATCTACGATCAGTTCATGCCGCCCGAAGAGGCA
CGGGATAAGCTCGATCAGATCAAGGGACACTTGGTGTGGATGCCCATGGCGTTCCTGGAAGACGCTGAGATGGCG
GAACGGGGGTTGCAGGTCAACGCTTGGACGGAAAGCCGAGCCGCCGCGCCACGGACGTTCGTCGGAGGTGAAGCG
GCGTCGCAAGCGCCGAGATGGGGCCAATCGGGAGGGGAGCTGGAGACGGCGTGCGCAGGCCACAGCTGCCTGGCT
GTGCTGCTGAGCATGGGATTCGTTGAGACTCTGCCGTGGACTGCTCCGGATATCACGCTCGGGCCGCATAAGAGG
TCGCCGACGCAGCGCTCTGCCGTCGCTCGCCGTCGACGGCAGCTGCTCGGGGGTCAGCTCAGAGCGGCTCCAGCT
GCCGTCGCCGTCGCCGCTGCGTGCGACCGGCCGGCTGTCGTGATCGCCGTCGGCCTACGACCTCGTCCCGTCGCA
CAAGACACCATGACGCAGTCGCCCATGATCTCGGCGCCAATCAAGGCGACTAACGAGATCGACTGGGTCGGTCCT
CTCAAGACCTACATCCGCGACACGTATGGCGACGATCCCGAACGATACGCCGAGGAGTGTGCCACCCTCAACCGT
CTGAGGCAGAACATGCGCGGGGCGGGAAAGGACAGCATCCCCGGCCGCGACATCCTCTACCGCTACTACGGTCAA
CTAGAGCTCCTTGACCTGCGCTTCCCCGTCGATGAACAGCACATCAAGATATCATTCACCTGGTTCGATGCCTTC
ACCCACAAGCCCACCACCCAATACTCGCTCGCGTTCGAAAAGGCCTCCGTCATCTTCAACATCTCCGCCGTTCTG
TCCTGCCATGGAGCCCTGCAGAACCGCGCCGACGATCCGGCCCTCAAGACGGCCTATCACTCGTTCCAGGCTTCT
GCCGGCATGTTCACCTACATCAACGACAACTTTCTCCATGCCCCGTCCTTCGACCTGAGCCGAGAGTGTGTCAAG
GCCCTGATTCAGGTCATGCTCGCGCAAGCTCAAGAGATATTCCTCGAGAAGCAGGTGGCTGATCAGAAGAAGATT
GGCTTGCTGGCCAAGCTGGCCTCGCAAACCGCTTATCTCTACGGTCAAGCCGTTGAAGGTGTTCAGGAAAACGTC
AACAAGGCCGTGTTTGAGAAGGTGTGGTTGACGCTGGTCCAGGTGAAGACGAGTCTCTTCAACTCGAAAGCCCAG
TATTACCAGGCGCTGGCCGACGCCGAAGGAGGAGAACATGGAGCCGCCGTCTCGCGCCTCCGTGTCGCCGAGGCC
CTGGCAAAAGAAGCCGAACGCACGTCGAGAACCTTGCCGGCTACCCTTCCGGCGGGCTGCAATCTAAGCGCCGAA
ACGAGCGGGATCTTGCAAGAGCTTTCAAAGCGGCAGTACGCCACCGTGCAGGAAAAGCTGATCGAGGAGGTCAAG
GACAATGACTTTGTCTACCACCAAACCGTTCCACCAGAGCCCAGCCTGCCGCCCATTCCCAAGCTGCCCGCGGCC
AAGCCGATACCAGTCAGTGAGCTGTACGCGGGTCAGGACATCTCGCGCATCACGGGGCCCGACCTGTTTTCCAAA
ATCGTCCCCTTGGCCGTAACGGAGTCGGCGAGTCTGTACGACGAGGAGAAGGCGAAGCTAGTGAGGGCCGAGACG
GAGAAAGCAGATATGGCCAATGGGGAGATGGCGGCCGCTCTTGACTATCTGCGGCTTCCCGGGGCGTTGCAAGTC
CTCAAGGGGGGGTTCGATCAAGAACTTCTCCCGGACGAGGACTTTAAGCAGTGGTGTGACGACGTTGCTGACCAC
GAGAACCCGAACGCTATTCTCGAGTGGCTGAGGTCGGAGAAGGAGTCGATCGTGTCTATTCTCGACAGGAGTGGG
AAGCAGCTCGACATGGAGGAGAGCGTGTGCGAGAAGATGCGGTCGAAATATGATGGCGAATGGAGCCAGCAACCG
AGCGCTCGACTAACGACGACGCTCCGAGGAGACATCCGCAGTTACCGAGAGGCGCTGGAAGAGGCCATGGCGAGC
GACAGCCAGCTGGATGCGAAGCTGCGCCAGAGCGCCGGGGAGTTTGACGAGATGCGACGGGCAGCCCAGAACGGC
GAGGTAGACGGGCTCTACCAGAGAGCCGTGGCGGCGGCCAAAGGCAAGGCTGGAAGCGTCTCGACGAGCGCGCCC
GACCCCGAGCCCAACCTGCTGGACGCCGACTTTGGCGAGGGCGAATCGAGCGTGGCCGACCAGGTGGCGAGGGTC
GAGGATTTGCTCAAGAAGCTGAATCTGGTGAAGAGGGAGCGGAATCAAGTGCTCAAGGATTTGAAGGAAAAGGTG
AGTCTTTCGGTCCGCGACTGGGCGAGGATGAGCGAGATACTAAAGGAGCGTTTGAAGGTCCACAACGACGATATT
TCACAGGTTCTGATTCTCAATAAAAAGTCTATTTCCAACTACGAGACCCAGCTGTTCGAGCAGGAGCTCGGGAAA
TTCCGGCCGCACCAGAATCGGCTGCTGCAGGCAAACCACAAGCAGTCAGCCCTGATGAAGGAATTGACGACTCTC
TACAACGCGCTGCTTCAGGACAAGCGGGTGCGGAATGAGCGCACGAAATACGAGGCCATCCAGCGGCAGACGTCG
GCGGTGGTCAACAGATACAAGCGAGCATATCAGGAGTTTCTCGACCTCGAGGCCGGTCTTCAGAGCGCGAAAAAC
TGGTACGCAGAGATGAGGGAGACAGCTGAGAGCCTTGAGAAGAACGTGGAGACGTTTGTCAACAACCGGAGGTCG
GAAGGCGCTCAGCTGCTTAACCAGATCGAACAGGATCGGTCGGTGAGCAAGAACAGCCAGGCGGAACTGGAGCGG
GAGCGGCTACGGGGTCTTATGGAGCGCATGTCGATGGAACCGGCCAAGTCGCCGCCGCGGCCGGCTTCCGGGCGG
CCGACGCCGGCCCCGCTGCCGCTGTCTCAGACGGGCCCGGGGCCGGCCCGGTATCCGCAGACAAACTATCAGGGC
CACTACCAGGTGCCGACGTCGCCGCCGCCCAACAACGCGGGCCACATGCAGCAGCAGGTTCATCACCAGCAACAT
CAGCACTCAGCCTATGGCGGCTATAGCAGCCCAGCCGGCGCGGCTGGCGGCTTCTCGCCGCCGACGTACAACCCA
AGCCAATATGGCCCGACGGCAGGGCCCCGTTCGCCGCCGCCGACACAGACATCCTTTGGGCCGGGAGCGCGTGCT
CCACAGCCCTACCAGTCTTACGGAGGGCCCCAGGGGCCGGGTACCGCCATGCCGCCAGGTTTCGTACCGCCACCG
CCGCCTCCAGGACCGCCGCCGTTGGGGCCGCAGCAGACCATACACTACGGGAACCAAGAGTATGAGGTGCCTCAG
GGCACACAGTCGGGGCCGTCGCAAGGCCAACAGCCCCACGATCCATGGGCGGGACTCAGCGCGTGGAAATAG
Gene >Ophun1|6632
ATGTCGGAGTCAAAGGACGATCAGGGCAGCTTCTCGTCCTTCGTCGACGACCTCAAGGACAAGCTTCACGATAGT
AAGCTTCACGACGCAAAGGTCCATCTCACTCATAAAAAGTTCGTGCTTCTCTTCGCCTCTCGCCCAGGTCCTGTT
CCGCATGATCGCTGACGTCGCATTCCTTTGTTCAGGCACCAGATTGGAAAGCTGGGCAACCTGGTAAGTGCATGA
TCACTGTTATGTCGTTTAATTCCCACTCGCCACGCGTCGTGTGTTTCGTCGTGTACCTCCGCAGTCTGACCAAGA
CCATTGCAGTTCAACAGAGACCACCGCCACGATGAAGAGCACGAGCAGAGATGCGACGAAAAGAGGACCAAGACA
TGCGAAACCCACCGCTACGAGTCATTTTTCCCCGAACGAGACGGGAACCTCGTCAAGTGGTACGTCGACGGTCGC
GACTACTTCTGGGCCGTTTCGGTGGCTCTAGAAGAGGCTCAAGAGACCATCTACATTGCCGACTGGTGGCTTTCG
CCCGAGCTCTTTCTCCGACGTCCGCCGTATCACAAGCAGGAGCACCGTCTTGATCAGATCCTGAAGCGGCGGGCA
GAGGCGGGGGNNCACCTCCCGCCATACCAAGAATGCGCTGCAGTCTCTTTGTCCCGAGGGCACGCCGGGTTACGG
CAACATCCGCGTGGTGCGACACCCGGACCACAACGTCTTCGAGAACGCTGCCGACATGACCATGTACTGGGCCCA
TCACGAAAAGTTCATTGTCATCGACTACTACCTGGCCTTCATCGGCGGGCTTGATCTCTGCTTTGGCCGCTGGGA
TGCTCGGCAGCACCCTCTCTCCGACGTCCATCCCGAGGGCGTCTCGGAGGAGATATGGCCAGGCCAGGACTTCAA
CAACAACCGTATCATGGACTTCAAAAAGGTCGAGGATTGGCAGCAGAACGAACTTAGCAAGGCCGAGTTTGGCCG
CATGCCATGGCATGACGTAGCCATGGCGCTCATCGGCCCCTGCGTTTACGACATCGCCGAGCACTTCGTCCTGCG
TTGGAACTTTATCAAGCGGGACAAGCACAAGCGCGACGAGCGTCATGACTGGCTGGTCCTCGAGGGCCGCGAAGG
AGATGACGAGGACCTGGTCGGCGTTCAGCGACCCAAGCACCCTGTCGGAGAATACGTCAAGCATCCCCTGACGCC
CCTCGCCTCCAAGAACCTCGAGAACCGGGGCACGATCCACGCCCAAGTCGTTCGCTCGAGCGCCGACTGGTCCAG
CGGGATTCTCAATGACCATTCCATTCAGAACGCCTACTGCGAGGTCATCCGGAAAGCAGAGCACTACGTCTATAT
CGAGAATCAATTCTTCATCACTGCCACGGGCGACCAGCAGCCTCCCATCCACAACACCATCGGCGCGGCCATGGT
GGACGCCGTTGTGCGAGCGGCTAAGGAGGGCCGCAAATTTCGTATCATCGTCATCCTCCCGGCGATACCGGGCTT
CGCTGGTGACCTGCGGGAAAACGCGGCTTCGGGCACTCGAGCCATCATGGACTATCAATACAAGTCGATATGTCG
CGGCGAGCACTCCATCTTTGGCCGCATCAAGGCTCAGGGCGTCGACCCGAATCAGCACATCTTCTTCTTCAATCT
CCGTTCCTACGACCGCCTCAACAAGACAAATGCCATTACTGTTGCAGAGAAGAAGACTGGGATCAGCTACCAACA
GGTGCAACGAGCCGAGGCGGAAGAGATCATGGCTGAGGGCGTTTACGGGTACGAAGACGACAGCTCCGATGACGG
CAGGCGGTCGAAGCGCCACGAAAAGACCAATGCACAAAGGGGGCCATCGGAGAACGTGATTAAGGCGAGAGAGGT
ATTCGACGAGGCAAAGCCTGATGAGGAAGTAGTATCGGCCGCATCCGTTGCCCACCACGCTCTGGCCGGTCAGGG
CTCTCTCAAGGACGAGCCATGGGATACCCACGCAGATCCAGAGTCTGAGATACGGAACTGGATCCAAGAAGAGCT
CTACGTCCACGCGAAGCTTGTCATTGCTGACGATCGGGTCGTCATCTGCGGTTCAAGCAATATCAACGACCGCAG
CCAGCTGGGAGACCACGACAGCGAGCTCAGCATTGTCATGGAAGACACAAGGATGATTCCAAGCACAATGGATGG
ACAGCCGTTCGAGGCCGGCTGGCATGCTGCCACGTTGCGCCGCTTCCTGTGGCGCGAGCATCTGGGCCTCCTCCC
GCCGCAGGACCTGGATGCCGCCGACGACATCAATGCGCAGCCTCCCACGGTGAATCCGGAAAACAACATATACGA
CGACATCGATAGCTACAAGTTTGTCGAGGATCCTTTGGGTGACGACCTGTGGTCCATGTGGACCGGGCAGGCAGA
CAAGAACACGGGCTTGTTCCGGCACCTATTCCACGCGGACCCGGACGACAAGAGTAAGTTCAAACGCCGTGTTCT
GGAAATACTCTTCAAGAAGGCGCGCGCTGATGAGGAGCAGTCAAAACGTTTGAGGACTACGACCGATATCTCCCG
CCCAAGGGTGTCAAGTCGGGTCACATCTACGATCAGTTCATGCCGCCCGAAGAGGCACGGGATAAGCTCGATCAG
ATCAAGGGACACTTGGTGTGGATGCCCATGGCGTTCCTGGAAGACGCTGAGATGGCGGAACGGGGGTTGCAGGTC
AACGCTTGGACGGAAAGCGTGTATACCTAGAGGCGTTTGTCGATGGGGAGTCTGGGATGGGAGTTGGCCGGGTTT
CGCACAAGAGGTTATCGGAGAATTTGACTGTTTTCTCGTTATTTCGCAAAGCGCGGGTGATGTGTCGAAAACTGG
CATGCCGGATCTGGCCGCAGATCTGGCCGCAGCTGACGGGAGCGGCATGGTAATCTCCATCGAGGCCCACAGGCT
ATGAAGTGATCGTGATGAGGGTTTTCCATTATCCATTGTCCGTCATCGATGGACATATTCGTAGGTATTCGTACC
TACTTGTGTTTGCCAGATTCGTTACTGGTTTGCTTCTGCACACGGACCTCTCCCCGCAGCGAGCCGCCGCGCCAC
GGACGTTCGTCGGAGGTGAAGCGGCGTCGCAAGCGCCGAGATGGGGCCAATCGGGAGGGGAGCTGGAGACGGCGT
GCGCAGGCCACAGCTGCCTGGCTGTGCTGCTGAGCATGGGATTCGTTGGTGCGACTCGTCTGCCGTATCGTATAG
AGTTGACGTGTGCGTCCAATGCGCATGGCTTTCGACCACGCGCGGGCCAATGCCACGACGAGCTGCGGGAGTGCG
CGTGACGACGAGCGTGACGAAGGGATAGGTCACCACCAGAGGCGAGAACGCCAGGGAAGCGTGGGATATCAAACC
GACGAGGAGCGGAGAGATTAGATCAGCGGAGCTATGTAGGTGGGTATAGGGTAGCTAAGCCTTTCGGTGAGGCTC
CATCGGCGCCGCGAGGCATGGAGAGAACTTCACCTCGTCTACCGTGTGCATACCTCCGTCAGATCTCGCCTTTGC
AGCTTCATACACGGCTTCAGCAAGATATTGTCTTCGAGACACACCCGACCAGCCTATCCGGAGCTCAATCTCCTC
GACTGCCAACCTCTCATCGTCCCAAGTCCTCGGTCCGTATTCGTGCCTTGGCTCCCCCTCCGTCTCTCGGCCGTT
CTCTCGCCCCCCCCTTGTGTCATAACTCTCAAACCCGGCCCGCAGAACGAGGCCTGGACCCCGCTTCTCCTCCGG
CTCCGGGAACGATTAGGACGTCGTGAGAGACTCTGCCGTGGACTGCTCCGGATATCACGCTCGGGCCGCATAAGA
GGTCGCCGACGCAGCGCTCTGCCGTCGCTCGCCGTCGACGGCAGCTGCTCGGGGGTCAGCTCAGAGCGGCTCCAG
CTGCCGTCGCCGTCGCCGCTGCGTGCGACCGGCCGGCTGTCGTGATCGCCGTCGGCCTACGACCTCGTCCCGTCG
CACAAGACACCATGACGCAGTCGCCCATGATCTCGGCGCCAATCAAGGCGACTAACGAGATCGACTGGGTCGGTC
CTCTCAAGACCTACATCCGCGACACGTATGGCGACGATCCCGAACGATACGCCGAGGAGTGTGCCACCCTCAACC
GTCTGAGGCAGAACATGCGCGGGGCGGGAAAGGACAGCATCCCCGGCCGCGACATCCTCTACCGCTACTACGGTC
AACTAGAGCTCCTTGACCTGCGCTTCCCCGTCGATGAACAGCACATCAAGATATCATTCACCTGGTACAATATGC
CGCCAGACCAAGCCTCATCTTGACAGCAGAGCTAACAGTTGCTCCTCTGCCAGGTTCGATGCCTTCACCCACAAG
CCCACCACCCAATACTCGCTCGCGTTCGAAAAGGCCTCCGTCATCTTCAACATCTCCGCCGTTCTGTCCTGCCAT
GGAGCCCTGCAGAACCGCGCCGACGATCCGGCCCTCAAGACGGCCTATCACTCGTTCCAGGCTTCTGCCGGCATG
TTCACCTACATCAACGACAACTTTCTCCATGCCCCGTCCTTCGACCTGAGCCGAGAGTGTGTCAAGGCCCTGATT
CAGGTCATGCTCGCGCAAGCTCAAGAGATATTCCTCGAGAAGCAGGTGGCTGATCAGAAGAAGATTGGCTTGCTG
GCCAAGCTGGCCTCGCAAACCGCTTATCTCTACGGTCAAGCCGTTGAAGGTGTTCAGGAAAACGTCAACAAGGCC
GTGTTTGAGAAGGTGTGGTTGACGCTGGTCCAGGTATGTCGCGGTCGCAGGGGATGTCGCCTCTCCTCCGTGGTG
CGCTCTGACCGGACATGATCTACAGGTGAAGACGAGTCTCTTCAACTCGAAAGCCCAGTATTACCAGGCGCTGGC
CGACGCCGAAGGAGGAGAACATGGAGCCGCCGTCTCGCGCCTCCGTGTCGCCGAGGCCCTGGCAAAAGAAGCCGA
ACGCACGTCGAGAACCTTGCCGGCTACCCTTCCGGCGGGCTGCAATCTAAGCGCCGAAACGAGCGGGATCTTGCA
AGAGCTTTCAAAGCGGCAGTACGCCACCGTGCAGGAAAAGCTGATCGAGGAGGTCAAGGACAATGACTTTGTCTA
CCACCAAACCGTTCCACCAGAGCCCAGCCTGCCGCCCATTCCCAAGCTGCCCGCGGCCAAGCCGATACCAGTCAG
TGAGCTGTACGCGGGTCAGGACATCTCGCGCATCACGGGGCCCGACCTGTTTTCCAAAATCGTCCCCTTGGCCGT
AACGGAGTCGGCGAGTCTGTACGACGAGGAGAAGGCGAAGCTAGTGAGGGCCGAGACGGAGAAAGCAGATATGGC
CAATGGGGAGATGGCGGCCGCTCTTGACTATCTGCGGCTTCCCGGGGCGTTGCAAGTCCTCAAGGGGGGGTTCGA
TCAAGAACTTCTCCCGGACGAGGACTTTAAGCAGTGGTGTGACGACGTTGCTGACCACGAGAACCCGAACGCTAT
TCTCGAGTGGCTGAGGTCGGAGAAGGAGTCGATCGTGTCTATTCTCGACAGGAGTGGGAAGCAGCTCGACATGGA
GGAGAGCGTGTGCGAGAAGATGCGGTCGAAATATGATGGCGAATGGAGCCAGCAACCGAGCGCTCGACTAACGAC
GACGCTCCGAGGAGACATCCGCAGTTACCGAGAGGCGCTGGAAGAGGCCATGGCGAGCGACAGCCAGCTGGATGC
GAAGCTGCGCCAGAGCGCCGGGGAGTTTGACGAGATGCGACGGGCAGCCCAGAACGGCGAGGTAGACGGGCTCTA
CCAGAGAGCCGTGGCGGCGGCCAAAGGCAAGGCTGGAAGCGTCTCGACGAGCGCGCCCGACCCCGAGCCCAACCT
GCTGGACGCCGACTTTGGCGAGGGCGAATCGAGCGTGGCCGACCAGGTGGCGAGGGTCGAGGATTTGCTCAAGAA
GCTGAATCTGGTGAAGAGGGAGCGGAATCAAGTGCTCAAGGATTTGAAGGAAAAGGTGAGTCTTTCGGTCCGCGA
CTGGGCGAGGATGAGCGAGATACTAAAGGAGCGTTTGAAGGTCCACAACGACGATATTTCACAGGTTCTGATTCT
CAATAAAAAGTCTATTTCCAACTACGAGACCCAGCTGTTCGAGCAGGAGCTCGGGAAATTCCGGCCGCACCAGAA
TCGGCTGCTGCAGGCAAACCACAAGCAGTCAGCCCTGATGAAGGAATTGACGACTCTCTACAACGCGCTGCTTCA
GGACAAGCGGGTGCGGAATGAGCGCACGAAATACGAGGCCATCCAGCGGCAGACGTCGGCGGTGGTCAACAGATA
CAAGCGAGCATATCAGGAGTTTCTCGACCTCGAGGCCGGTCTTCAGAGCGCGAAAAACTGGTACGCAGAGATGAG
GGAGACAGCTGAGAGCCTTGAGAAGAACGTGGAGACGTTTGTCAACAACCGGAGGTCGGAAGGCGCTCAGCTGCT
TAACCAGATCGAACAGGATCGGTCGGTGAGCAAGAACAGCCAGGCGGAACTGGAGCGGGAGCGGCTACGGGGTCT
TATGGAGCGCATGTCGATGGAACCGGCCAAGTCGCCGCCGCGGCCGGCTTCCGGGCGGCCGACGCCGGCCCCGCT
GCCGCTGTCTCAGACGGGCCCGGGGCCGGCCCGGTATCCGCAGACAAACTATCAGGGCCACTACCAGGTGCCGAC
GTCGCCGCCGCCCAACAACGCGGGCCACATGCAGCAGCAGGTTCATCACCAGCAACATCAGCACTCAGCCTATGG
CGGCTATAGCAGCCCAGCCGGCGCGGCTGGCGGCTTCTCGCCGCCGACGTACAACCCAAGCCAATATGGCCCGAC
GGCAGGGCCCCGTTCGCCGCCGCCGACACAGACATCCTTTGGGCCGGGAGCGCGTGCTCCACAGCCCTACCAGTC
TTACGGAGGGCCCCAGGGGCCGGGTACCGCCATGCCGCCAGGTTTCGTACCGCCACCGCCGCCTCCAGGACCGCC
GCCGTTGGGGCCGCAGCAGACCATACACTACGGGAACCAAGAGTATGAGGTGCCTCAGGGCACACAGTCGGGGCC
GTCGCAAGGCCAACAGCCCCACGATCCATGGGCGGGACTCAGCGCGTGGAAATAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail