Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6628
Gene name
LocationContig_74:9117..10810
Strand+
Gene length (bp)1693
Transcript length (bp)1575
Coding sequence length (bp)1575
Protein length (aa) 525

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 2.6E-13 296 338
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 2.1E-08 294 342
PF17123 zf-RING_11 RING-like zinc finger 1.8E-10 296 324
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 2.6E-08 296 337
PF12678 zf-rbx1 RING-H2 zinc finger domain 2.3E-07 300 338
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.6E-06 297 337
PF13445 zf-RING_UBOX RING-type zinc-finger 1.6E-06 297 335

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=3 SV=1 234 365 9.0E-21
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 235 345 3.0E-18
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 243 345 2.0E-17
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 242 346 5.0E-17
sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=1 SV=1 251 345 5.0E-17
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C1X4|YKW3_SCHPO Uncharacterized RING finger protein P32A8.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP32A8.03c PE=3 SV=1 234 365 9.0E-21
sp|Q8LPN7|RNG1L_ARATH E3 ubiquitin-protein ligase RING1-like OS=Arabidopsis thaliana GN=At3g19950 PE=1 SV=1 235 345 3.0E-18
sp|Q6DIP3|RN126_XENTR E3 ubiquitin-protein ligase RNF126 OS=Xenopus tropicalis GN=rnf126 PE=2 SV=1 243 345 2.0E-17
sp|Q9D0C1|RN115_MOUSE E3 ubiquitin-protein ligase RNF115 OS=Mus musculus GN=Rnf115 PE=1 SV=1 242 346 5.0E-17
sp|P0CH30|RING1_GOSHI E3 ubiquitin-protein ligase RING1 OS=Gossypium hirsutum GN=RING1 PE=1 SV=1 251 345 5.0E-17
sp|Q7T0Q3|R126A_XENLA E3 ubiquitin-protein ligase RNF126-A OS=Xenopus laevis GN=rnf126-a PE=2 SV=1 243 345 6.0E-17
sp|Q9Y4L5|RN115_HUMAN E3 ubiquitin-protein ligase RNF115 OS=Homo sapiens GN=RNF115 PE=1 SV=2 242 346 8.0E-17
sp|Q6IRP0|R126B_XENLA E3 ubiquitin-protein ligase RNF126-B OS=Xenopus laevis GN=rnf126-b PE=2 SV=1 243 345 2.0E-16
sp|Q91YL2|RN126_MOUSE E3 ubiquitin-protein ligase RNF126 OS=Mus musculus GN=Rnf126 PE=1 SV=1 243 345 7.0E-16
sp|Q9BV68|RN126_HUMAN E3 ubiquitin-protein ligase RNF126 OS=Homo sapiens GN=RNF126 PE=1 SV=1 21 345 8.0E-16
sp|Q0II22|RN126_BOVIN E3 ubiquitin-protein ligase RNF126 OS=Bos taurus GN=RNF126 PE=2 SV=1 243 345 3.0E-15
sp|Q8RXD3|AIP2_ARATH E3 ubiquitin-protein ligase AIP2 OS=Arabidopsis thaliana GN=AIP2 PE=1 SV=1 251 345 1.0E-14
sp|Q9VE61|RN181_DROME E3 ubiquitin-protein ligase RNF181 homolog OS=Drosophila melanogaster GN=CG7694 PE=2 SV=1 269 345 3.0E-12
sp|Q9SPL2|CIP8_ARATH E3 ubiquitin-protein ligase CIP8 OS=Arabidopsis thaliana GN=CIP8 PE=1 SV=1 235 346 7.0E-12
sp|Q566M8|RN150_DANRE RING finger protein 150 OS=Danio rerio GN=rnf150 PE=2 SV=1 164 341 2.0E-10
sp|P0C035|ATL60_ARATH RING-H2 finger protein ATL60 OS=Arabidopsis thaliana GN=ATL60 PE=2 SV=1 296 341 3.0E-10
sp|Q9Y252|RNF6_HUMAN E3 ubiquitin-protein ligase RNF6 OS=Homo sapiens GN=RNF6 PE=1 SV=1 277 348 4.0E-10
sp|Q9DBU5|RNF6_MOUSE E3 ubiquitin-protein ligase RNF6 OS=Mus musculus GN=Rnf6 PE=1 SV=1 272 341 7.0E-10
sp|Q9H9V4|RN122_HUMAN RING finger protein 122 OS=Homo sapiens GN=RNF122 PE=2 SV=2 280 343 1.0E-09
sp|Q8NG27|PJA1_HUMAN E3 ubiquitin-protein ligase Praja-1 OS=Homo sapiens GN=PJA1 PE=1 SV=2 267 338 1.0E-09
sp|Q8BP31|RN122_MOUSE RING finger protein 122 OS=Mus musculus GN=Rnf122 PE=2 SV=1 280 341 2.0E-09
sp|P30631|YOUD_CAEEL Uncharacterized RING finger protein ZK637.14 OS=Caenorhabditis elegans GN=ZK637.14 PE=3 SV=2 272 344 2.0E-09
sp|Q9LUL6|ATL61_ARATH Putative RING-H2 finger protein ATL61 OS=Arabidopsis thaliana GN=ATL61 PE=3 SV=1 296 372 2.0E-09
sp|O55176|PJA1_MOUSE E3 ubiquitin-protein ligase Praja-1 OS=Mus musculus GN=Pja1 PE=1 SV=3 267 338 3.0E-09
sp|Q9XF63|ATL3_ARATH RING-H2 finger protein ATL3 OS=Arabidopsis thaliana GN=ATL3 PE=2 SV=1 296 341 4.0E-09
sp|Q9NVW2|RNF12_HUMAN E3 ubiquitin-protein ligase RLIM OS=Homo sapiens GN=RLIM PE=1 SV=3 277 343 5.0E-09
sp|Q84TF5|RHA4A_ARATH RING-H2 zinc finger protein RHA4a OS=Arabidopsis thaliana GN=RHA4A PE=2 SV=1 291 349 5.0E-09
sp|Q8NC42|RN149_HUMAN E3 ubiquitin-protein ligase RNF149 OS=Homo sapiens GN=RNF149 PE=2 SV=2 210 341 7.0E-09
sp|Q9SLC3|ATL41_ARATH E3 ubiquitin-protein ligase ATL41 OS=Arabidopsis thaliana GN=ATL41 PE=1 SV=1 291 342 8.0E-09
sp|Q8VEM1|GOLI_MOUSE E3 ubiquitin-protein ligase RNF130 OS=Mus musculus GN=Rnf130 PE=2 SV=1 282 341 8.0E-09
sp|Q6Y290|GOLI_RAT E3 ubiquitin-protein ligase RNF130 OS=Rattus norvegicus GN=Rnf130 PE=1 SV=1 282 341 9.0E-09
sp|Q5R4R1|PJA2_PONAB E3 ubiquitin-protein ligase Praja-2 OS=Pongo abelii GN=PJA2 PE=2 SV=1 267 338 1.0E-08
sp|Q9WTV7|RNF12_MOUSE E3 ubiquitin-protein ligase RLIM OS=Mus musculus GN=Rlim PE=1 SV=2 277 341 1.0E-08
sp|O43164|PJA2_HUMAN E3 ubiquitin-protein ligase Praja-2 OS=Homo sapiens GN=PJA2 PE=1 SV=4 267 338 1.0E-08
sp|Q5SSZ7|ZNRF3_MOUSE E3 ubiquitin-protein ligase ZNRF3 OS=Mus musculus GN=Znrf3 PE=1 SV=1 247 347 1.0E-08
sp|O64763|ATL9_ARATH E3 ubiquitin-protein ligase ATL9 OS=Arabidopsis thaliana GN=ATL9 PE=1 SV=1 291 369 1.0E-08
sp|Q86XS8|GOLI_HUMAN E3 ubiquitin-protein ligase RNF130 OS=Homo sapiens GN=RNF130 PE=1 SV=1 282 341 1.0E-08
sp|Q8BGI1|RNF24_MOUSE RING finger protein 24 OS=Mus musculus GN=Rnf24 PE=2 SV=1 297 341 2.0E-08
sp|Q80U04|PJA2_MOUSE E3 ubiquitin-protein ligase Praja-2 OS=Mus musculus GN=Pja2 PE=1 SV=2 267 338 2.0E-08
sp|Q9CY62|RN181_MOUSE E3 ubiquitin-protein ligase RNF181 OS=Mus musculus GN=Rnf181 PE=1 SV=1 269 360 2.0E-08
sp|Q6GPV5|RN181_XENLA E3 ubiquitin-protein ligase RNF181 OS=Xenopus laevis GN=rnf181 PE=2 SV=1 269 345 2.0E-08
sp|Q8LBA0|NIPL2_ARATH NEP1-interacting protein-like 2 OS=Arabidopsis thaliana GN=ATL24 PE=1 SV=2 272 342 2.0E-08
sp|Q9Y225|RNF24_HUMAN RING finger protein 24 OS=Homo sapiens GN=RNF24 PE=1 SV=1 297 341 2.0E-08
sp|Q3U2C5|RN149_MOUSE E3 ubiquitin-protein ligase RNF149 OS=Mus musculus GN=Rnf149 PE=1 SV=3 297 341 2.0E-08
sp|Q8GXF8|SHGR9_ARATH E3 ubiquitin-protein ligase SGR9, amyloplastic OS=Arabidopsis thaliana GN=SGR9 PE=1 SV=1 294 346 2.0E-08
sp|Q07G42|RNF12_XENTR E3 ubiquitin-protein ligase RNF12 OS=Xenopus tropicalis GN=rnf12 PE=2 SV=1 277 341 3.0E-08
sp|Q9ULK6|RN150_HUMAN RING finger protein 150 OS=Homo sapiens GN=RNF150 PE=2 SV=2 184 341 3.0E-08
sp|Q63364|PJA2_RAT E3 ubiquitin-protein ligase Praja-2 OS=Rattus norvegicus GN=Pja2 PE=2 SV=1 267 338 3.0E-08
sp|Q6NRX0|RN149_XENLA E3 ubiquitin-protein ligase RNF149 OS=Xenopus laevis GN=rnf149 PE=2 SV=1 224 341 3.0E-08
sp|Q7ZW78|RN181_DANRE E3 ubiquitin-protein ligase RNF181 OS=Danio rerio GN=rnf181 PE=2 SV=2 269 366 3.0E-08
sp|Q5DTZ6|RN150_MOUSE RING finger protein 150 OS=Mus musculus GN=Rnf150 PE=2 SV=2 184 341 3.0E-08
sp|Q641J8|RF12A_XENLA E3 ubiquitin-protein ligase RNF12-A OS=Xenopus laevis GN=rnf12-a PE=1 SV=1 297 341 3.0E-08
sp|Q5M974|RN181_XENTR E3 ubiquitin-protein ligase RNF181 OS=Xenopus tropicalis GN=rnf181 PE=2 SV=1 269 345 4.0E-08
sp|Q9LY41|ATL4_ARATH E3 ubiquitin-protein ligase ATL4 OS=Arabidopsis thaliana GN=ATL4 PE=1 SV=1 296 360 4.0E-08
sp|Q7T037|RF12B_XENLA E3 ubiquitin-protein ligase RNF12-B OS=Xenopus laevis GN=rnf12-b PE=2 SV=1 297 341 4.0E-08
sp|Q8SV35|Y733_ENCCU Uncharacterized RING finger protein ECU07_0330 OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU07_0330 PE=3 SV=2 176 341 5.0E-08
sp|E9QAU8|RN165_MOUSE RING finger protein 165 OS=Mus musculus GN=Rnf165 PE=2 SV=1 212 349 6.0E-08
sp|Q9SLC4|ATL40_ARATH RING-H2 finger protein ATL40 OS=Arabidopsis thaliana GN=ATL40 PE=2 SV=1 295 342 6.0E-08
sp|Q99ML9|RN111_MOUSE E3 ubiquitin-protein ligase Arkadia OS=Mus musculus GN=Rnf111 PE=1 SV=1 277 343 6.0E-08
sp|P87139|YDM9_SCHPO Uncharacterized RING finger protein C57A7.09 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC57A7.09 PE=1 SV=1 284 341 6.0E-08
sp|Q9Y3C5|RNF11_HUMAN RING finger protein 11 OS=Homo sapiens GN=RNF11 PE=1 SV=1 296 343 7.0E-08
sp|Q08DI6|RNF11_BOVIN RING finger protein 11 OS=Bos taurus GN=RNF11 PE=2 SV=1 296 343 7.0E-08
sp|Q5R476|RN111_PONAB E3 ubiquitin-protein ligase Arkadia OS=Pongo abelii GN=RNF111 PE=2 SV=1 277 343 7.0E-08
sp|Q9QYK7|RNF11_MOUSE RING finger protein 11 OS=Mus musculus GN=Rnf11 PE=1 SV=1 296 343 7.0E-08
sp|Q6ZNA4|RN111_HUMAN E3 ubiquitin-protein ligase Arkadia OS=Homo sapiens GN=RNF111 PE=1 SV=3 277 343 7.0E-08
sp|Q10R93|RMR1_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 1 OS=Oryza sativa subsp. japonica GN=Os03g0167500 PE=2 SV=1 293 338 8.0E-08
sp|Q8L9W3|ATL23_ARATH E3 ubiquitin-protein ligase ATL23 OS=Arabidopsis thaliana GN=ATL23 PE=1 SV=2 270 352 8.0E-08
sp|Q3T0W3|RN181_BOVIN E3 ubiquitin-protein ligase RNF181 OS=Bos taurus GN=RNF181 PE=2 SV=1 269 345 8.0E-08
sp|Q6ZSG1|RN165_HUMAN RING finger protein 165 OS=Homo sapiens GN=RNF165 PE=1 SV=1 212 349 9.0E-08
sp|Q8L9T5|ATL2_ARATH RING-H2 finger protein ATL2 OS=Arabidopsis thaliana GN=ATL2 PE=2 SV=2 295 343 1.0E-07
sp|Q69U49|RMR2_ORYSJ Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Oryza sativa subsp. japonica GN=RMR1 PE=2 SV=2 293 338 1.0E-07
sp|Q9M2S6|SDIR1_ARATH E3 ubiquitin-protein ligase SDIR1 OS=Arabidopsis thaliana GN=SDIR1 PE=1 SV=1 292 338 1.0E-07
sp|Q6AXU4|RN181_RAT E3 ubiquitin-protein ligase RNF181 OS=Rattus norvegicus GN=Rnf181 PE=1 SV=1 269 360 1.0E-07
sp|Q5RF74|RN128_PONAB E3 ubiquitin-protein ligase RNF128 OS=Pongo abelii GN=RNF128 PE=2 SV=1 276 341 1.0E-07
sp|Q9FG21|ATL71_ARATH Putative RING-H2 finger protein ATL71 OS=Arabidopsis thaliana GN=ATL71 PE=3 SV=1 289 339 1.0E-07
sp|Q9Y7K6|YGI4_SCHPO Uncharacterized RING finger protein C2A9.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC2A9.04c PE=3 SV=1 271 350 1.0E-07
sp|Q06003|GOLI_DROME Protein goliath OS=Drosophila melanogaster GN=gol PE=2 SV=3 297 341 1.0E-07
sp|Q7XLY8|ATL41_ORYSJ E3 ubiquitin-protein ligase Os04g0590900 OS=Oryza sativa subsp. japonica GN=Os04g0590900 PE=2 SV=2 266 341 1.0E-07
sp|Q8W571|ATL32_ARATH RING-H2 finger protein ATL32 OS=Arabidopsis thaliana GN=ATL32 PE=2 SV=3 271 343 2.0E-07
sp|Q3UHJ8|RNF44_MOUSE RING finger protein 44 OS=Mus musculus GN=Rnf44 PE=2 SV=1 294 338 2.0E-07
sp|Q9ULT6|ZNRF3_HUMAN E3 ubiquitin-protein ligase ZNRF3 OS=Homo sapiens GN=ZNRF3 PE=1 SV=3 297 349 2.0E-07
sp|Q4V7B8|RNF44_RAT RING finger protein 44 OS=Rattus norvegicus GN=Rnf44 PE=2 SV=1 294 338 2.0E-07
sp|Q9D304|RN128_MOUSE E3 ubiquitin-protein ligase RNF128 OS=Mus musculus GN=Rnf128 PE=1 SV=1 276 341 2.0E-07
sp|Q9P0P0|RN181_HUMAN E3 ubiquitin-protein ligase RNF181 OS=Homo sapiens GN=RNF181 PE=1 SV=1 269 345 3.0E-07
sp|Q9LRB7|EL5_ORYSJ E3 ubiquitin-protein ligase EL5 OS=Oryza sativa subsp. japonica GN=EL5.1 PE=1 SV=1 295 338 3.0E-07
sp|Q8TEB7|RN128_HUMAN E3 ubiquitin-protein ligase RNF128 OS=Homo sapiens GN=RNF128 PE=1 SV=1 276 341 3.0E-07
sp|O22755|ATL44_ARATH RING-H2 finger protein ATL44 OS=Arabidopsis thaliana GN=ATL44 PE=2 SV=1 295 376 3.0E-07
sp|Q6NML0|ATL76_ARATH E3 ubiquitin-protein ligase ATL76 OS=Arabidopsis thaliana GN=ATL76 PE=1 SV=1 274 338 3.0E-07
sp|Q8AWW4|RN128_XENLA E3 ubiquitin-protein ligase RNF128 OS=Xenopus laevis GN=rnf128 PE=2 SV=2 262 341 3.0E-07
sp|Q9FLC6|ATL73_ARATH RING-H2 finger protein ATL73 OS=Arabidopsis thaliana GN=ATL73 PE=2 SV=1 259 338 3.0E-07
sp|Q570X5|ATL58_ARATH RING-H2 finger protein ATL58 OS=Arabidopsis thaliana GN=ATL58 PE=2 SV=1 295 341 4.0E-07
sp|Q4KLR8|ZNRF3_XENLA E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus laevis GN=znrf3 PE=2 SV=1 247 341 4.0E-07
sp|Q7L0R7|RNF44_HUMAN RING finger protein 44 OS=Homo sapiens GN=RNF44 PE=2 SV=1 294 338 4.0E-07
sp|Q9ZU51|RHA2B_ARATH Probable E3 ubiquitin-protein ligase RHA2B OS=Arabidopsis thaliana GN=RHA2B PE=1 SV=2 293 367 4.0E-07
sp|Q8VZ14|RMR2_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 2 OS=Arabidopsis thaliana GN=RMR2 PE=2 SV=1 297 338 5.0E-07
sp|Q0V9R0|RN111_XENTR E3 ubiquitin-protein ligase arkadia OS=Xenopus tropicalis GN=rnf111 PE=2 SV=1 296 342 5.0E-07
sp|Q29RU0|RN128_BOVIN E3 ubiquitin-protein ligase RNF128 OS=Bos taurus GN=RNF128 PE=2 SV=1 276 341 5.0E-07
sp|Q84W40|ATL11_ARATH RING-H2 finger protein ATL11 OS=Arabidopsis thaliana GN=ATL11 PE=2 SV=2 217 341 5.0E-07
sp|Q66J97|R111C_XENLA E3 ubiquitin-protein ligase arkadia-C OS=Xenopus laevis GN=rnf111-c PE=2 SV=1 296 342 6.0E-07
sp|Q6NRV8|R111B_XENLA E3 ubiquitin-protein ligase arkadia-B OS=Xenopus laevis GN=rnf111-b PE=2 SV=1 296 342 6.0E-07
sp|A5WWA0|ZNRF3_DANRE E3 ubiquitin-protein ligase ZNRF3 OS=Danio rerio GN=znrf3 PE=1 SV=2 297 348 6.0E-07
sp|Q8LF65|ATL17_ARATH RING-H2 finger protein ATL17 OS=Arabidopsis thaliana GN=ATL17 PE=2 SV=2 296 342 6.0E-07
sp|Q90ZT7|R111A_XENLA E3 ubiquitin-protein ligase arkadia-A (Fragment) OS=Xenopus laevis GN=rnf111-a PE=2 SV=1 296 342 6.0E-07
sp|F4I2Y3|RMR3_ARATH Receptor homology region, transmembrane domain- and RING domain-containing protein 3 OS=Arabidopsis thaliana GN=RMR3 PE=3 SV=1 297 338 7.0E-07
sp|Q9H0F5|RNF38_HUMAN E3 ubiquitin-protein ligase RNF38 OS=Homo sapiens GN=RNF38 PE=1 SV=4 294 338 9.0E-07
sp|Q9H6Y7|RN167_HUMAN E3 ubiquitin-protein ligase RNF167 OS=Homo sapiens GN=RNF167 PE=1 SV=1 277 341 1.0E-06
sp|Q9ZT50|RHA2A_ARATH E3 ubiquitin-protein ligase RHA2A OS=Arabidopsis thaliana GN=RHA2A PE=1 SV=1 295 345 1.0E-06
sp|Q9LSW9|ATL16_ARATH RING-H2 finger protein ATL16 OS=Arabidopsis thaliana GN=ATL16 PE=2 SV=1 296 346 1.0E-06
sp|Q91XF4|RN167_MOUSE E3 ubiquitin-protein ligase RNF167 OS=Mus musculus GN=Rnf167 PE=2 SV=1 277 341 1.0E-06
sp|Q9LS99|ATL77_ARATH RING-H2 finger protein ATL77 OS=Arabidopsis thaliana GN=ATL77 PE=2 SV=1 296 338 1.0E-06
sp|Q90972|RNF13_CHICK E3 ubiquitin-protein ligase RNF13 OS=Gallus gallus GN=RNF13 PE=1 SV=1 290 390 1.0E-06
sp|Q08CG8|RNF44_DANRE RING finger protein 44 OS=Danio rerio GN=rnf44 PE=2 SV=1 294 338 1.0E-06
sp|Q68DV7|RNF43_HUMAN E3 ubiquitin-protein ligase RNF43 OS=Homo sapiens GN=RNF43 PE=1 SV=1 293 349 1.0E-06
sp|Q9M0R7|ATL39_ARATH RING-H2 finger protein ATL39 OS=Arabidopsis thaliana GN=ATL39 PE=2 SV=1 291 341 1.0E-06
sp|Q8BI21|RNF38_MOUSE E3 ubiquitin-protein ligase RNF38 OS=Mus musculus GN=Rnf38 PE=2 SV=1 294 338 1.0E-06
sp|Q9ZT49|ATL45_ARATH RING-H2 finger protein ATL45 OS=Arabidopsis thaliana GN=ATL45 PE=2 SV=1 291 346 1.0E-06
sp|Q94BY6|ATL75_ARATH RING-H2 finger protein ATL75 OS=Arabidopsis thaliana GN=ATL75 PE=2 SV=1 274 338 2.0E-06
sp|Q9SJJ7|ATL57_ARATH RING-H2 finger protein ATL57 OS=Arabidopsis thaliana GN=ATL57 PE=2 SV=1 296 374 2.0E-06
sp|P0C034|ATL10_ARATH RING-H2 finger protein ATL10 OS=Arabidopsis thaliana GN=ATL10 PE=2 SV=1 274 338 2.0E-06
sp|Q8L649|BB_ARATH E3 ubiquitin ligase BIG BROTHER OS=Arabidopsis thaliana GN=BB PE=1 SV=1 272 341 2.0E-06
sp|Q8RXX9|ATL6_ARATH E3 ubiquitin-protein ligase ATL6 OS=Arabidopsis thaliana GN=ATL6 PE=1 SV=2 291 355 2.0E-06
sp|Q5XIL0|RN167_RAT E3 ubiquitin-protein ligase RNF167 OS=Rattus norvegicus GN=Rnf167 PE=2 SV=1 277 341 2.0E-06
sp|Q9LX93|ATL55_ARATH E3 ubiquitin-protein ligase RING1 OS=Arabidopsis thaliana GN=ATL55 PE=1 SV=1 279 341 2.0E-06
sp|Q9LT17|BBR_ARATH E3 ubiquitin ligase BIG BROTHER-related OS=Arabidopsis thaliana GN=BBR PE=2 SV=1 297 341 2.0E-06
sp|Q9EPZ8|RN103_RAT E3 ubiquitin-protein ligase RNF103 OS=Rattus norvegicus GN=Rnf103 PE=2 SV=1 295 340 3.0E-06
sp|O54965|RNF13_MOUSE E3 ubiquitin-protein ligase RNF13 OS=Mus musculus GN=Rnf13 PE=1 SV=2 290 390 3.0E-06
sp|Q8LC69|ATL8_ARATH RING-H2 finger protein ATL8 OS=Arabidopsis thaliana GN=ATL8 PE=2 SV=2 274 338 3.0E-06
sp|Q66HG0|RNF13_RAT E3 ubiquitin-protein ligase RNF13 OS=Rattus norvegicus GN=Rnf13 PE=2 SV=1 290 390 3.0E-06
sp|Q9LZV8|ATL74_ARATH RING-H2 finger protein ATL74 OS=Arabidopsis thaliana GN=ATL74 PE=2 SV=1 291 341 3.0E-06
sp|O00237|RN103_HUMAN E3 ubiquitin-protein ligase RNF103 OS=Homo sapiens GN=RNF103 PE=1 SV=1 295 340 3.0E-06
sp|Q6NKR1|ATL28_ARATH RING-H2 finger protein ATL28 OS=Arabidopsis thaliana GN=ATL28 PE=2 SV=1 295 342 3.0E-06
sp|Q9R1W3|RN103_MOUSE E3 ubiquitin-protein ligase RNF103 OS=Mus musculus GN=Rnf103 PE=2 SV=2 295 340 3.0E-06
sp|Q95K04|RN133_MACFA E3 ubiquitin-protein ligase RNF133 OS=Macaca fascicularis GN=RNF133 PE=2 SV=1 297 341 4.0E-06
sp|Q9SRQ8|ATL51_ARATH RING-H2 finger protein ATL51 OS=Arabidopsis thaliana GN=ATL51 PE=2 SV=2 286 439 4.0E-06
sp|Q9LM69|ATL80_ARATH RING-H2 finger protein ATL80 OS=Arabidopsis thaliana GN=ATL80 PE=2 SV=1 269 338 4.0E-06
sp|Q940Q4|ATL13_ARATH RING-H2 finger protein ATL13 OS=Arabidopsis thaliana GN=ATL13 PE=2 SV=2 296 338 4.0E-06
sp|Q0IJ20|RN145_XENTR RING finger protein 145 OS=Xenopus tropicalis GN=rnf145 PE=2 SV=1 297 404 4.0E-06
sp|Q8H7N9|ATL31_ORYSJ E3 ubiquitin-protein ligase Os03g0188200 OS=Oryza sativa subsp. japonica GN=Os03g0188200 PE=2 SV=1 273 343 4.0E-06
sp|O80927|ATL33_ARATH RING-H2 finger protein ATL33 OS=Arabidopsis thaliana GN=ATL33 PE=2 SV=2 292 343 5.0E-06
sp|Q5NCP0|RNF43_MOUSE E3 ubiquitin-protein ligase RNF43 OS=Mus musculus GN=Rnf43 PE=2 SV=1 297 337 5.0E-06
sp|Q08D68|ZNRF3_XENTR E3 ubiquitin-protein ligase ZNRF3 OS=Xenopus tropicalis GN=znrf3 PE=1 SV=1 297 341 5.0E-06
sp|O64762|ATL38_ARATH RING-H2 finger protein ATL38 OS=Arabidopsis thaliana GN=ATL38 PE=2 SV=1 246 341 5.0E-06
sp|Q8N7C7|RN148_HUMAN RING finger protein 148 OS=Homo sapiens GN=RNF148 PE=2 SV=2 276 341 6.0E-06
sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 297 341 6.0E-06
sp|Q8GYT9|SIS3_ARATH E3 ubiquitin-protein ligase SIS3 OS=Arabidopsis thaliana GN=SIS3 PE=2 SV=2 296 367 6.0E-06
sp|Q8LGA5|ATL31_ARATH E3 ubiquitin-protein ligase ATL31 OS=Arabidopsis thaliana GN=ATL31 PE=1 SV=2 291 339 6.0E-06
sp|Q7X843|ATL48_ARATH RING-H2 finger protein ATL48 OS=Arabidopsis thaliana GN=ATL48 PE=1 SV=2 292 352 7.0E-06
sp|Q9LZJ6|ATL5_ARATH RING-H2 finger protein ATL5 OS=Arabidopsis thaliana GN=ATL5 PE=2 SV=1 296 342 7.0E-06
sp|Q9LUZ9|ATL63_ARATH RING-H2 finger protein ATL63 OS=Arabidopsis thaliana GN=ATL63 PE=2 SV=1 297 343 8.0E-06
sp|Q9FKX5|NIPL1_ARATH NEP1-interacting protein-like 1 OS=Arabidopsis thaliana GN=ATL27 PE=2 SV=1 295 338 8.0E-06
sp|Q8WVZ7|RN133_HUMAN E3 ubiquitin-protein ligase RNF133 OS=Homo sapiens GN=RNF133 PE=2 SV=1 297 341 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6628
MASRGHRGGLLDATSDRSVVYCHACTNQWYRDGHDLRCPACGSDITEIVELNTDPRAPHNYHSPPSATPVHYEYD
DGSDPDVADIDEFTGPHGFIHRRSIRTGRDEAGHHDPGVEPVLHRFYEMLQTFSPIRATPGQENPPERGEPGSPP
WPRIQRTTFTSGPFGSGTASVTIFTGSPPARQQGAENPHNGTSPDPYQTVLSQALRDLTVPQGQNPAAQLHQATR
SLQEFLSLFNPANAMSGDAVYSQEALDRIITQLMDTNPQSNAAPPASAEALRTLERKSVDREMLRGESKTECTIC
IEDMTIGDQAVVLPCKHWFHEDCVVLWLKEHNTCPICRTPIEADNANNSHNQGGGDHATRTTSRTESGTDGPGLP
PRPSRGLRGHGDASERSGPPAANASGGHAAEYAEGYRPLRLEAFRASYLGSQERGDRAQGRETPMRPVFHHGSRQ
WSSSSRESPDSTATGDRGAQVPRRSSSGNGRGGQGGDGASGRPTSQGPFSWLRERFTGGGSYSGNAPRGERRYH*
Coding >Ophun1|6628
ATGGCTTCTCGCGGCCATCGCGGTGGGCTTCTCGACGCGACTAGCGACCGCTCTGTCGTCTACTGCCACGCCTGT
ACCAACCAGTGGTATCGGGACGGGCATGATTTGCGCTGTCCGGCTTGCGGAAGCGACATCACCGAAATTGTTGAA
CTCAATACCGACCCTCGCGCGCCGCATAATTATCATTCACCTCCCTCTGCAACGCCCGTTCATTACGAATACGAT
GACGGTTCAGACCCCGACGTTGCCGACATCGACGAGTTCACCGGACCGCATGGCTTCATCCACCGCCGAAGCATC
CGCACGGGTCGCGATGAAGCCGGACACCACGACCCGGGTGTCGAGCCTGTCCTTCATCGCTTCTACGAAATGCTT
CAGACCTTTAGCCCCATCCGGGCAACTCCCGGTCAAGAAAACCCTCCAGAGCGAGGCGAGCCCGGCTCCCCGCCT
TGGCCTCGAATCCAACGCACCACATTCACGTCTGGGCCGTTTGGTAGTGGAACCGCGTCTGTCACCATCTTCACT
GGCTCGCCGCCTGCCCGTCAGCAGGGTGCAGAAAACCCGCACAATGGCACTTCCCCTGATCCATATCAAACAGTC
CTCTCACAAGCGCTGCGGGATCTGACTGTGCCGCAGGGTCAGAACCCGGCGGCACAGCTTCACCAGGCCACCCGG
AGCTTGCAGGAGTTTTTGAGTCTTTTCAATCCGGCCAACGCCATGTCTGGCGATGCCGTTTATTCACAGGAGGCG
CTCGACCGTATCATCACGCAGCTGATGGACACGAACCCCCAGTCCAACGCCGCGCCTCCAGCCTCAGCGGAAGCC
CTAAGGACCCTGGAGCGGAAGAGTGTCGATCGAGAAATGCTCCGGGGCGAAAGCAAGACGGAGTGCACCATCTGC
ATCGAAGACATGACCATTGGTGATCAGGCCGTCGTTCTACCTTGCAAGCACTGGTTTCACGAGGATTGCGTCGTC
TTGTGGCTGAAGGAGCACAACACATGCCCTATTTGCAGGACGCCCATCGAGGCGGACAACGCAAATAACAGCCAC
AACCAAGGCGGCGGCGACCATGCCACGCGCACGACGTCGAGGACAGAATCAGGTACCGACGGCCCCGGGTTACCG
CCAAGGCCGTCGCGAGGCCTGCGAGGTCATGGAGATGCGTCCGAGAGGTCGGGCCCTCCTGCGGCCAATGCCTCG
GGCGGCCATGCAGCTGAGTACGCGGAAGGCTACCGTCCACTGCGGCTCGAAGCCTTTCGAGCCTCGTATCTTGGC
TCGCAGGAGAGGGGCGACAGAGCACAGGGGCGAGAGACGCCGATGCGGCCCGTCTTTCACCACGGCTCGCGACAA
TGGTCGTCTTCGTCCCGGGAAAGCCCCGACAGTACGGCGACGGGGGATCGTGGCGCTCAGGTGCCGCGGAGAAGC
TCGTCAGGCAACGGCCGAGGCGGACAAGGAGGCGATGGGGCTTCAGGCAGGCCGACGAGCCAGGGGCCTTTTAGC
TGGCTGCGGGAGCGCTTCACCGGCGGCGGATCCTACTCGGGCAATGCGCCCCGCGGTGAGAGACGGTATCACTAG
Transcript >Ophun1|6628
ATGGCTTCTCGCGGCCATCGCGGTGGGCTTCTCGACGCGACTAGCGACCGCTCTGTCGTCTACTGCCACGCCTGT
ACCAACCAGTGGTATCGGGACGGGCATGATTTGCGCTGTCCGGCTTGCGGAAGCGACATCACCGAAATTGTTGAA
CTCAATACCGACCCTCGCGCGCCGCATAATTATCATTCACCTCCCTCTGCAACGCCCGTTCATTACGAATACGAT
GACGGTTCAGACCCCGACGTTGCCGACATCGACGAGTTCACCGGACCGCATGGCTTCATCCACCGCCGAAGCATC
CGCACGGGTCGCGATGAAGCCGGACACCACGACCCGGGTGTCGAGCCTGTCCTTCATCGCTTCTACGAAATGCTT
CAGACCTTTAGCCCCATCCGGGCAACTCCCGGTCAAGAAAACCCTCCAGAGCGAGGCGAGCCCGGCTCCCCGCCT
TGGCCTCGAATCCAACGCACCACATTCACGTCTGGGCCGTTTGGTAGTGGAACCGCGTCTGTCACCATCTTCACT
GGCTCGCCGCCTGCCCGTCAGCAGGGTGCAGAAAACCCGCACAATGGCACTTCCCCTGATCCATATCAAACAGTC
CTCTCACAAGCGCTGCGGGATCTGACTGTGCCGCAGGGTCAGAACCCGGCGGCACAGCTTCACCAGGCCACCCGG
AGCTTGCAGGAGTTTTTGAGTCTTTTCAATCCGGCCAACGCCATGTCTGGCGATGCCGTTTATTCACAGGAGGCG
CTCGACCGTATCATCACGCAGCTGATGGACACGAACCCCCAGTCCAACGCCGCGCCTCCAGCCTCAGCGGAAGCC
CTAAGGACCCTGGAGCGGAAGAGTGTCGATCGAGAAATGCTCCGGGGCGAAAGCAAGACGGAGTGCACCATCTGC
ATCGAAGACATGACCATTGGTGATCAGGCCGTCGTTCTACCTTGCAAGCACTGGTTTCACGAGGATTGCGTCGTC
TTGTGGCTGAAGGAGCACAACACATGCCCTATTTGCAGGACGCCCATCGAGGCGGACAACGCAAATAACAGCCAC
AACCAAGGCGGCGGCGACCATGCCACGCGCACGACGTCGAGGACAGAATCAGGTACCGACGGCCCCGGGTTACCG
CCAAGGCCGTCGCGAGGCCTGCGAGGTCATGGAGATGCGTCCGAGAGGTCGGGCCCTCCTGCGGCCAATGCCTCG
GGCGGCCATGCAGCTGAGTACGCGGAAGGCTACCGTCCACTGCGGCTCGAAGCCTTTCGAGCCTCGTATCTTGGC
TCGCAGGAGAGGGGCGACAGAGCACAGGGGCGAGAGACGCCGATGCGGCCCGTCTTTCACCACGGCTCGCGACAA
TGGTCGTCTTCGTCCCGGGAAAGCCCCGACAGTACGGCGACGGGGGATCGTGGCGCTCAGGTGCCGCGGAGAAGC
TCGTCAGGCAACGGCCGAGGCGGACAAGGAGGCGATGGGGCTTCAGGCAGGCCGACGAGCCAGGGGCCTTTTAGC
TGGCTGCGGGAGCGCTTCACCGGCGGCGGATCCTACTCGGGCAATGCGCCCCGCGGTGAGAGACGGTATCACTAG
Gene >Ophun1|6628
ATGGCTTCTCGCGGCCATCGCGGTGGGCTTCTCGACGCGACTAGCGACCGCTCTGTCGTCTACTGCCACGCCTGT
ACCAACCAGTGGTATCGGGACGGGCATGATTTGCGCTGTCCGGCTTGCGGAAGCGACATCACCGAAATTGTACGT
CGTCTCTCCTTTCCAAGACTTTGTACCTGCTGACTCTCGGCTTCCTCACAGGTTGAACTCAATACCGACCCTCGC
GCGCCGCATAATTATCATTCACCTCCCTCTGCAACGCCCGTTCATTACGAATACGATGACGGTTCAGACCCCGAC
GTTGCCGACATCGACGAGTTCACCGGACCGCATGGCTTCATCCACCGCCGAAGCATCCGCACGGGTCGCGATGAA
GCCGGACACCACGACCCGGGTGTCGAGCCTGTCCTTCATCGCTTCTACGAAATGCTTCAGACCTTTAGCCCCATC
CGGGCAACTCCCGGTCAAGAAAACCCTCCAGAGCGAGGCGAGCCCGGCTCCCCGCCTTGGCCTCGAATCCAACGC
ACCACATTCACGTCTGGGCCGTTTGGTAGTGGAACCGCGTCTGTCACCATCTTCACTGGCTCGCCGCCTGCCCGT
CAGCAGGGTGCAGAAAACCCGCACAATGGCACTTCCCCTGATCCATATCAAACGTAAGTCTTCAATTCAATGCCA
CCCGTCCATAGTGGCCGGTAAAGCTGACTTGAATGGCAGAGTCCTCTCACAAGCGCTGCGGGATCTGACTGTGCC
GCAGGGTCAGAACCCGGCGGCACAGCTTCACCAGGCCACCCGGAGCTTGCAGGAGTTTTTGAGTCTTTTCAATCC
GGCCAACGCCATGTCTGGCGATGCCGTTTATTCACAGGAGGCGCTCGACCGTATCATCACGCAGCTGATGGACAC
GAACCCCCAGTCCAACGCCGCGCCTCCAGCCTCAGCGGAAGCCCTAAGGACCCTGGAGCGGAAGAGTGTCGATCG
AGAAATGCTCCGGGGCGAAAGCAAGACGGAGTGCACCATCTGCATCGAAGACATGACCATTGGTGATCAGGCCGT
CGTTCTACCTTGCAAGCACTGGTTTCACGAGGATTGCGTCGTCTTGTGGCTGAAGGAGCACAACACATGCCCTAT
TTGCAGGACGCCCATCGAGGCGGACAACGCAAATAACAGCCACAACCAAGGCGGCGGCGACCATGCCACGCGCAC
GACGTCGAGGACAGAATCAGGTACCGACGGCCCCGGGTTACCGCCAAGGCCGTCGCGAGGCCTGCGAGGTCATGG
AGATGCGTCCGAGAGGTCGGGCCCTCCTGCGGCCAATGCCTCGGGCGGCCATGCAGCTGAGTACGCGGAAGGCTA
CCGTCCACTGCGGCTCGAAGCCTTTCGAGCCTCGTATCTTGGCTCGCAGGAGAGGGGCGACAGAGCACAGGGGCG
AGAGACGCCGATGCGGCCCGTCTTTCACCACGGCTCGCGACAATGGTCGTCTTCGTCCCGGGAAAGCCCCGACAG
TACGGCGACGGGGGATCGTGGCGCTCAGGTGCCGCGGAGAAGCTCGTCAGGCAACGGCCGAGGCGGACAAGGAGG
CGATGGGGCTTCAGGCAGGCCGACGAGCCAGGGGCCTTTTAGCTGGCTGCGGGAGCGCTTCACCGGCGGCGGATC
CTACTCGGGCAATGCGCCCCGCGGTGAGAGACGGTATCACTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail