Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6625
Gene name
LocationContig_74:2486..4922
Strand-
Gene length (bp)2436
Transcript length (bp)2436
Coding sequence length (bp)2436
Protein length (aa) 812

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01735 PLA2_B Lysophospholipase catalytic domain 8.2E-27 232 597

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q50L41|PA24F_MOUSE Cytosolic phospholipase A2 zeta OS=Mus musculus GN=Pla2g4f PE=2 SV=3 188 600 2.0E-33
sp|Q68DD2|PA24F_HUMAN Cytosolic phospholipase A2 zeta OS=Homo sapiens GN=PLA2G4F PE=2 SV=3 188 608 3.0E-30
sp|B1WAZ6|PA24A_XENTR Cytosolic phospholipase A2 OS=Xenopus tropicalis GN=pla2g4a PE=2 SV=1 181 481 2.0E-26
sp|P50392|PA24A_DANRE Cytosolic phospholipase A2 OS=Danio rerio GN=pla2g4a PE=2 SV=1 181 476 2.0E-25
sp|Q7T0T9|PA24A_XENLA Cytosolic phospholipase A2 OS=Xenopus laevis GN=pla2g4a PE=2 SV=1 181 481 1.0E-24
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q50L41|PA24F_MOUSE Cytosolic phospholipase A2 zeta OS=Mus musculus GN=Pla2g4f PE=2 SV=3 188 600 2.0E-33
sp|Q68DD2|PA24F_HUMAN Cytosolic phospholipase A2 zeta OS=Homo sapiens GN=PLA2G4F PE=2 SV=3 188 608 3.0E-30
sp|B1WAZ6|PA24A_XENTR Cytosolic phospholipase A2 OS=Xenopus tropicalis GN=pla2g4a PE=2 SV=1 181 481 2.0E-26
sp|P50392|PA24A_DANRE Cytosolic phospholipase A2 OS=Danio rerio GN=pla2g4a PE=2 SV=1 181 476 2.0E-25
sp|Q7T0T9|PA24A_XENLA Cytosolic phospholipase A2 OS=Xenopus laevis GN=pla2g4a PE=2 SV=1 181 481 1.0E-24
sp|Q50L42|PA24E_MOUSE Cytosolic phospholipase A2 epsilon OS=Mus musculus GN=Pla2g4e PE=1 SV=1 188 584 2.0E-24
sp|P0C869|PA24B_HUMAN Cytosolic phospholipase A2 beta OS=Homo sapiens GN=PLA2G4B PE=1 SV=2 188 577 6.0E-23
sp|P0C871|PA24B_MOUSE Cytosolic phospholipase A2 beta OS=Mus musculus GN=Pla2g4b PE=2 SV=1 188 480 7.0E-23
sp|Q50L43|PA24D_MOUSE Cytosolic phospholipase A2 delta OS=Mus musculus GN=Pla2g4d PE=2 SV=3 188 487 3.0E-22
sp|Q5R8A5|PA24A_PONAB Cytosolic phospholipase A2 OS=Pongo abelii GN=PLA2G4A PE=2 SV=1 155 476 5.0E-22
sp|P47712|PA24A_HUMAN Cytosolic phospholipase A2 OS=Homo sapiens GN=PLA2G4A PE=1 SV=2 181 476 5.0E-22
sp|A4IFJ5|PA24A_BOVIN Cytosolic phospholipase A2 OS=Bos taurus GN=PLA2G4A PE=1 SV=1 181 476 5.0E-22
sp|P49147|PA24A_CHICK Cytosolic phospholipase A2 OS=Gallus gallus GN=PLA2G4A PE=1 SV=1 181 476 8.0E-22
sp|O77793|PA24A_HORSE Cytosolic phospholipase A2 OS=Equus caballus GN=PLA2G4A PE=2 SV=1 155 476 9.0E-22
sp|Q3MJ16|PA24E_HUMAN Cytosolic phospholipase A2 epsilon OS=Homo sapiens GN=PLA2G4E PE=2 SV=3 188 480 5.0E-21
sp|Q9TT38|PA24A_RABIT Cytosolic phospholipase A2 OS=Oryctolagus cuniculus GN=PLA2G4A PE=2 SV=1 181 476 1.0E-20
sp|P47713|PA24A_MOUSE Cytosolic phospholipase A2 OS=Mus musculus GN=Pla2g4a PE=1 SV=1 155 476 1.0E-20
sp|P50393|PA24A_RAT Cytosolic phospholipase A2 OS=Rattus norvegicus GN=Pla2g4a PE=1 SV=1 155 476 3.0E-20
sp|Q9P8P2|PLB1_CRYNH Phospholipase B OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=PLB1 PE=1 SV=2 189 581 1.0E-18
sp|P0CP74|PLB1_CRYNJ Phospholipase B OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PLB1 PE=3 SV=1 189 581 2.0E-18
sp|P0CP75|PLB1_CRYNB Phospholipase B OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PLB1 PE=3 SV=1 189 581 2.0E-18
sp|Q86XP0|PA24D_HUMAN Cytosolic phospholipase A2 delta OS=Homo sapiens GN=PLA2G4D PE=2 SV=2 188 480 3.0E-18
sp|P39105|PLB1_YEAST Lysophospholipase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLB1 PE=1 SV=2 188 602 4.0E-18
sp|Q9UP65|PA24C_HUMAN Cytosolic phospholipase A2 gamma OS=Homo sapiens GN=PLA2G4C PE=1 SV=2 185 492 6.0E-17
sp|Q11121|PLB1_TORDE Lysophospholipase OS=Torulaspora delbrueckii PE=1 SV=1 188 602 6.0E-16
sp|O13857|PLB2_SCHPO Putative lysophospholipase C1A6.03c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1A6.03c PE=3 SV=3 191 581 1.0E-14
sp|Q9P327|PLB4_SCHPO Putative lysophospholipase C977.09c/C1348.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC977.09c PE=2 SV=1 191 606 8.0E-13
sp|Q8TG07|PLB1_CANGA Lysophospholipase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PLB1 PE=3 SV=2 188 610 4.0E-12
sp|Q9Y7N6|PLB5_SCHPO Putative lysophospholipase C1450.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1450.09c PE=3 SV=3 191 604 1.0E-09
sp|Q03674|PLB2_YEAST Lysophospholipase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PLB2 PE=1 SV=1 185 610 5.0E-09
sp|P78854|PLB1_SCHPO Lysophospholipase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=plb1 PE=2 SV=2 191 604 1.0E-08
sp|O93795|PLB2_CANAX Lysophospholipase 2 OS=Candida albicans GN=PLB2 PE=3 SV=1 197 610 2.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0004620 phospholipase activity Yes
GO:0009395 phospholipid catabolic process Yes
GO:0006796 phosphate-containing compound metabolic process No
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0016788 hydrolase activity, acting on ester bonds No
GO:0003824 catalytic activity No
GO:0006629 lipid metabolic process No
GO:0009987 cellular process No
GO:0008152 metabolic process No
GO:0044242 cellular lipid catabolic process No
GO:0006644 phospholipid metabolic process No
GO:0016298 lipase activity No
GO:0009056 catabolic process No
GO:1901575 organic substance catabolic process No
GO:0044255 cellular lipid metabolic process No
GO:0044248 cellular catabolic process No
GO:0016042 lipid catabolic process No
GO:0006793 phosphorus metabolic process No
GO:0046434 organophosphate catabolic process No
GO:0003674 molecular_function No
GO:0019637 organophosphate metabolic process No
GO:0008150 biological_process No
GO:0016787 hydrolase activity No
GO:0071704 organic substance metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

Domain # Start End Length
1 51 70 19

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6625
MMWRIGAHATRPVRVSILRGASHRSLPRLQQLREAHSTNPKSSKHESTHRLASVASASLVAGWLFIWWLYPSDNF
AHLSIVSDTADTTIRRHDESHSPAAEETSHEKSGWANFARRFESLSLITDVEWTKLSEQVFGSLLPEWSKLIPGY
VKKLQRELSMSPGSLAEEIWQEAHDFHINPEIRYSARVRVSNDLCDEEKQYLARRRAVVRAALAKYLDLEEADIH
PSDIPTIATCGSGGGLRALIAGTGSLLAAEEDGLLDCVTYTSGVSGSCWLQALYLSSIAKGSMSALLNHIKARAS
THIAYPPVAFHSLISLPTSKHLLSGLVEKLVGDDQADFGLVDIYGLLLGARYLVPRGELGVNERDFKLSNQQDFV
KLGQRPLPIYTAVRHEIPELDEDDVTASAAEEAKDRARREAWFQWYEFTPYEFFCEEFGAGIPTWAVGRRFSDGE
DVPLDHGFHLPEIRMPLLMGIFGSAFCATLSHYYREIRPLILSLSGFGAVDDLVSGKNEDLSKVHPIDPASIPNF
AYNMQGKLPKTTPKSIYEKEYIQLMDAGMSNNLPIYPLLRPGRQVDILIAFDASADIKTDNWLSVADGYARQRGV
KGWPVGIGWPQGGESPEQISAELAEAQASTTREAEHKLREAKAADQQSPFPKDEDVIDQSDSDSAASQAGDLGYC
TVWVGTTHERSSEPPPPPKAITDADSWKLMDPKAGIAVVYLPFLGNGSVPDVSPGSSDFLSTWNFVYTPDQIDAV
VRLARANYDEGRDQIRATIRAVYERKRQRRRQAEKKLRDELFSSIASRSEAVLLGEGDQFS*
Coding >Ophun1|6625
ATGATGTGGCGTATCGGAGCTCACGCCACCCGGCCGGTTCGCGTTTCGATATTGCGTGGCGCCAGTCATAGGTCC
CTTCCGCGATTACAGCAGCTACGCGAGGCGCACTCTACGAATCCCAAGTCAAGCAAGCATGAATCCACGCATCGG
CTGGCTTCAGTGGCTTCAGCGTCCTTGGTTGCTGGCTGGCTGTTCATCTGGTGGCTGTACCCATCGGACAACTTC
GCTCACCTCTCCATCGTCAGCGACACTGCAGACACTACCATTCGGCGACATGACGAGAGCCACAGCCCTGCAGCT
GAAGAGACATCGCACGAAAAGTCAGGCTGGGCAAACTTCGCGCGTAGGTTCGAGTCTCTATCTCTGATCACGGAT
GTCGAGTGGACCAAGTTGTCCGAACAAGTCTTCGGCTCTCTCCTACCCGAATGGTCCAAACTGATCCCCGGCTAC
GTCAAGAAGCTCCAGCGAGAGCTCTCAATGTCGCCTGGCTCCCTGGCCGAAGAGATCTGGCAAGAGGCCCATGAC
TTTCATATCAACCCGGAGATCCGGTACTCTGCCCGCGTCCGAGTTTCCAACGACCTTTGTGATGAGGAGAAGCAG
TATCTAGCGAGGCGTCGGGCTGTTGTCAGAGCCGCTCTGGCGAAGTATCTGGACTTGGAAGAAGCAGACATCCAT
CCCAGTGATATCCCGACCATCGCGACTTGCGGCTCCGGCGGAGGCTTGCGAGCCCTCATCGCCGGCACTGGGTCG
CTACTCGCTGCCGAGGAGGATGGCCTTCTTGACTGCGTGACTTACACGTCTGGCGTGAGCGGCTCATGCTGGCTG
CAAGCGCTGTACCTATCGTCGATTGCAAAGGGAAGCATGAGCGCCCTCCTGAATCATATCAAGGCTCGAGCCTCC
ACACACATCGCCTATCCGCCTGTGGCCTTTCACTCCCTCATCTCACTGCCAACCAGCAAGCACCTCCTCAGCGGC
TTAGTCGAGAAGCTTGTCGGTGACGATCAGGCCGACTTTGGCCTCGTCGACATCTACGGCCTCTTGCTGGGTGCG
CGGTACCTGGTGCCTCGGGGTGAGCTCGGCGTCAACGAGCGGGACTTTAAGCTTTCGAATCAACAAGACTTCGTC
AAGCTCGGACAACGGCCATTGCCCATCTATACCGCAGTCCGACACGAGATTCCCGAGCTCGATGAAGACGACGTG
ACAGCCTCGGCCGCCGAAGAGGCAAAGGATAGGGCTCGGCGGGAGGCTTGGTTCCAGTGGTACGAGTTCACGCCG
TACGAGTTCTTCTGCGAGGAGTTCGGCGCCGGCATCCCAACCTGGGCCGTCGGACGGAGATTCAGCGACGGCGAG
GACGTGCCCCTCGATCACGGCTTTCATCTGCCGGAGATTCGCATGCCGCTGCTGATGGGCATCTTTGGAAGTGCC
TTCTGCGCCACCCTCAGCCACTACTATCGCGAGATCAGGCCTCTAATCCTCAGCTTGTCGGGCTTCGGCGCCGTC
GACGACCTGGTATCGGGCAAGAACGAAGACCTGAGCAAAGTCCATCCCATCGATCCCGCCAGCATCCCCAACTTC
GCCTACAACATGCAGGGCAAGCTGCCAAAGACGACACCCAAGAGCATCTATGAGAAGGAGTACATCCAGCTGATG
GACGCCGGCATGTCCAATAACCTACCAATATACCCCCTCCTGCGTCCGGGTCGCCAAGTCGACATCCTCATCGCC
TTCGACGCCTCGGCAGACATCAAGACGGACAACTGGCTCTCCGTCGCCGACGGCTACGCCCGCCAGCGTGGCGTC
AAGGGCTGGCCAGTGGGCATCGGATGGCCTCAGGGCGGGGAATCGCCAGAGCAGATTTCGGCGGAGCTCGCCGAG
GCCCAGGCCAGCACGACACGCGAGGCCGAGCACAAACTGCGCGAGGCCAAAGCAGCCGACCAACAATCGCCCTTC
CCTAAAGACGAAGACGTCATCGACCAGAGCGACAGCGACTCCGCCGCCAGCCAAGCCGGCGATCTGGGCTACTGC
ACCGTCTGGGTTGGCACAACGCACGAACGGTCATCGGAGCCCCCCCCGCCGCCAAAGGCCATAACGGACGCCGAC
TCATGGAAGCTGATGGACCCGAAAGCCGGCATCGCCGTCGTTTACCTCCCCTTCCTTGGCAACGGCTCCGTCCCA
GACGTGTCGCCCGGCTCATCTGATTTCCTCAGCACCTGGAACTTCGTCTACACACCCGACCAGATCGACGCCGTC
GTCCGGCTCGCGCGCGCAAACTATGACGAGGGGAGGGATCAGATCAGAGCTACCATCCGCGCCGTCTACGAGCGC
AAGAGGCAGCGACGCCGGCAGGCGGAGAAGAAGCTGCGAGATGAGCTGTTCAGCAGCATAGCTAGCCGCTCAGAA
GCAGTGCTGCTCGGTGAAGGGGACCAGTTCAGCTAG
Transcript >Ophun1|6625
ATGATGTGGCGTATCGGAGCTCACGCCACCCGGCCGGTTCGCGTTTCGATATTGCGTGGCGCCAGTCATAGGTCC
CTTCCGCGATTACAGCAGCTACGCGAGGCGCACTCTACGAATCCCAAGTCAAGCAAGCATGAATCCACGCATCGG
CTGGCTTCAGTGGCTTCAGCGTCCTTGGTTGCTGGCTGGCTGTTCATCTGGTGGCTGTACCCATCGGACAACTTC
GCTCACCTCTCCATCGTCAGCGACACTGCAGACACTACCATTCGGCGACATGACGAGAGCCACAGCCCTGCAGCT
GAAGAGACATCGCACGAAAAGTCAGGCTGGGCAAACTTCGCGCGTAGGTTCGAGTCTCTATCTCTGATCACGGAT
GTCGAGTGGACCAAGTTGTCCGAACAAGTCTTCGGCTCTCTCCTACCCGAATGGTCCAAACTGATCCCCGGCTAC
GTCAAGAAGCTCCAGCGAGAGCTCTCAATGTCGCCTGGCTCCCTGGCCGAAGAGATCTGGCAAGAGGCCCATGAC
TTTCATATCAACCCGGAGATCCGGTACTCTGCCCGCGTCCGAGTTTCCAACGACCTTTGTGATGAGGAGAAGCAG
TATCTAGCGAGGCGTCGGGCTGTTGTCAGAGCCGCTCTGGCGAAGTATCTGGACTTGGAAGAAGCAGACATCCAT
CCCAGTGATATCCCGACCATCGCGACTTGCGGCTCCGGCGGAGGCTTGCGAGCCCTCATCGCCGGCACTGGGTCG
CTACTCGCTGCCGAGGAGGATGGCCTTCTTGACTGCGTGACTTACACGTCTGGCGTGAGCGGCTCATGCTGGCTG
CAAGCGCTGTACCTATCGTCGATTGCAAAGGGAAGCATGAGCGCCCTCCTGAATCATATCAAGGCTCGAGCCTCC
ACACACATCGCCTATCCGCCTGTGGCCTTTCACTCCCTCATCTCACTGCCAACCAGCAAGCACCTCCTCAGCGGC
TTAGTCGAGAAGCTTGTCGGTGACGATCAGGCCGACTTTGGCCTCGTCGACATCTACGGCCTCTTGCTGGGTGCG
CGGTACCTGGTGCCTCGGGGTGAGCTCGGCGTCAACGAGCGGGACTTTAAGCTTTCGAATCAACAAGACTTCGTC
AAGCTCGGACAACGGCCATTGCCCATCTATACCGCAGTCCGACACGAGATTCCCGAGCTCGATGAAGACGACGTG
ACAGCCTCGGCCGCCGAAGAGGCAAAGGATAGGGCTCGGCGGGAGGCTTGGTTCCAGTGGTACGAGTTCACGCCG
TACGAGTTCTTCTGCGAGGAGTTCGGCGCCGGCATCCCAACCTGGGCCGTCGGACGGAGATTCAGCGACGGCGAG
GACGTGCCCCTCGATCACGGCTTTCATCTGCCGGAGATTCGCATGCCGCTGCTGATGGGCATCTTTGGAAGTGCC
TTCTGCGCCACCCTCAGCCACTACTATCGCGAGATCAGGCCTCTAATCCTCAGCTTGTCGGGCTTCGGCGCCGTC
GACGACCTGGTATCGGGCAAGAACGAAGACCTGAGCAAAGTCCATCCCATCGATCCCGCCAGCATCCCCAACTTC
GCCTACAACATGCAGGGCAAGCTGCCAAAGACGACACCCAAGAGCATCTATGAGAAGGAGTACATCCAGCTGATG
GACGCCGGCATGTCCAATAACCTACCAATATACCCCCTCCTGCGTCCGGGTCGCCAAGTCGACATCCTCATCGCC
TTCGACGCCTCGGCAGACATCAAGACGGACAACTGGCTCTCCGTCGCCGACGGCTACGCCCGCCAGCGTGGCGTC
AAGGGCTGGCCAGTGGGCATCGGATGGCCTCAGGGCGGGGAATCGCCAGAGCAGATTTCGGCGGAGCTCGCCGAG
GCCCAGGCCAGCACGACACGCGAGGCCGAGCACAAACTGCGCGAGGCCAAAGCAGCCGACCAACAATCGCCCTTC
CCTAAAGACGAAGACGTCATCGACCAGAGCGACAGCGACTCCGCCGCCAGCCAAGCCGGCGATCTGGGCTACTGC
ACCGTCTGGGTTGGCACAACGCACGAACGGTCATCGGAGCCCCCCCCGCCGCCAAAGGCCATAACGGACGCCGAC
TCATGGAAGCTGATGGACCCGAAAGCCGGCATCGCCGTCGTTTACCTCCCCTTCCTTGGCAACGGCTCCGTCCCA
GACGTGTCGCCCGGCTCATCTGATTTCCTCAGCACCTGGAACTTCGTCTACACACCCGACCAGATCGACGCCGTC
GTCCGGCTCGCGCGCGCAAACTATGACGAGGGGAGGGATCAGATCAGAGCTACCATCCGCGCCGTCTACGAGCGC
AAGAGGCAGCGACGCCGGCAGGCGGAGAAGAAGCTGCGAGATGAGCTGTTCAGCAGCATAGCTAGCCGCTCAGAA
GCAGTGCTGCTCGGTGAAGGGGACCAGTTCAGCTAG
Gene >Ophun1|6625
ATGATGTGGCGTATCGGAGCTCACGCCACCCGGCCGGTTCGCGTTTCGATATTGCGTGGCGCCAGTCATAGGTCC
CTTCCGCGATTACAGCAGCTACGCGAGGCGCACTCTACGAATCCCAAGTCAAGCAAGCATGAATCCACGCATCGG
CTGGCTTCAGTGGCTTCAGCGTCCTTGGTTGCTGGCTGGCTGTTCATCTGGTGGCTGTACCCATCGGACAACTTC
GCTCACCTCTCCATCGTCAGCGACACTGCAGACACTACCATTCGGCGACATGACGAGAGCCACAGCCCTGCAGCT
GAAGAGACATCGCACGAAAAGTCAGGCTGGGCAAACTTCGCGCGTAGGTTCGAGTCTCTATCTCTGATCACGGAT
GTCGAGTGGACCAAGTTGTCCGAACAAGTCTTCGGCTCTCTCCTACCCGAATGGTCCAAACTGATCCCCGGCTAC
GTCAAGAAGCTCCAGCGAGAGCTCTCAATGTCGCCTGGCTCCCTGGCCGAAGAGATCTGGCAAGAGGCCCATGAC
TTTCATATCAACCCGGAGATCCGGTACTCTGCCCGCGTCCGAGTTTCCAACGACCTTTGTGATGAGGAGAAGCAG
TATCTAGCGAGGCGTCGGGCTGTTGTCAGAGCCGCTCTGGCGAAGTATCTGGACTTGGAAGAAGCAGACATCCAT
CCCAGTGATATCCCGACCATCGCGACTTGCGGCTCCGGCGGAGGCTTGCGAGCCCTCATCGCCGGCACTGGGTCG
CTACTCGCTGCCGAGGAGGATGGCCTTCTTGACTGCGTGACTTACACGTCTGGCGTGAGCGGCTCATGCTGGCTG
CAAGCGCTGTACCTATCGTCGATTGCAAAGGGAAGCATGAGCGCCCTCCTGAATCATATCAAGGCTCGAGCCTCC
ACACACATCGCCTATCCGCCTGTGGCCTTTCACTCCCTCATCTCACTGCCAACCAGCAAGCACCTCCTCAGCGGC
TTAGTCGAGAAGCTTGTCGGTGACGATCAGGCCGACTTTGGCCTCGTCGACATCTACGGCCTCTTGCTGGGTGCG
CGGTACCTGGTGCCTCGGGGTGAGCTCGGCGTCAACGAGCGGGACTTTAAGCTTTCGAATCAACAAGACTTCGTC
AAGCTCGGACAACGGCCATTGCCCATCTATACCGCAGTCCGACACGAGATTCCCGAGCTCGATGAAGACGACGTG
ACAGCCTCGGCCGCCGAAGAGGCAAAGGATAGGGCTCGGCGGGAGGCTTGGTTCCAGTGGTACGAGTTCACGCCG
TACGAGTTCTTCTGCGAGGAGTTCGGCGCCGGCATCCCAACCTGGGCCGTCGGACGGAGATTCAGCGACGGCGAG
GACGTGCCCCTCGATCACGGCTTTCATCTGCCGGAGATTCGCATGCCGCTGCTGATGGGCATCTTTGGAAGTGCC
TTCTGCGCCACCCTCAGCCACTACTATCGCGAGATCAGGCCTCTAATCCTCAGCTTGTCGGGCTTCGGCGCCGTC
GACGACCTGGTATCGGGCAAGAACGAAGACCTGAGCAAAGTCCATCCCATCGATCCCGCCAGCATCCCCAACTTC
GCCTACAACATGCAGGGCAAGCTGCCAAAGACGACACCCAAGAGCATCTATGAGAAGGAGTACATCCAGCTGATG
GACGCCGGCATGTCCAATAACCTACCAATATACCCCCTCCTGCGTCCGGGTCGCCAAGTCGACATCCTCATCGCC
TTCGACGCCTCGGCAGACATCAAGACGGACAACTGGCTCTCCGTCGCCGACGGCTACGCCCGCCAGCGTGGCGTC
AAGGGCTGGCCAGTGGGCATCGGATGGCCTCAGGGCGGGGAATCGCCAGAGCAGATTTCGGCGGAGCTCGCCGAG
GCCCAGGCCAGCACGACACGCGAGGCCGAGCACAAACTGCGCGAGGCCAAAGCAGCCGACCAACAATCGCCCTTC
CCTAAAGACGAAGACGTCATCGACCAGAGCGACAGCGACTCCGCCGCCAGCCAAGCCGGCGATCTGGGCTACTGC
ACCGTCTGGGTTGGCACAACGCACGAACGGTCATCGGAGCCCCCCCCGCCGCCAAAGGCCATAACGGACGCCGAC
TCATGGAAGCTGATGGACCCGAAAGCCGGCATCGCCGTCGTTTACCTCCCCTTCCTTGGCAACGGCTCCGTCCCA
GACGTGTCGCCCGGCTCATCTGATTTCCTCAGCACCTGGAACTTCGTCTACACACCCGACCAGATCGACGCCGTC
GTCCGGCTCGCGCGCGCAAACTATGACGAGGGGAGGGATCAGATCAGAGCTACCATCCGCGCCGTCTACGAGCGC
AAGAGGCAGCGACGCCGGCAGGCGGAGAAGAAGCTGCGAGATGAGCTGTTCAGCAGCATAGCTAGCCGCTCAGAA
GCAGTGCTGCTCGGTGAAGGGGACCAGTTCAGCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail