Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6624
Gene name
LocationContig_74:465..2137
Strand+
Gene length (bp)1672
Transcript length (bp)1542
Coding sequence length (bp)1542
Protein length (aa) 514

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05383 La La domain 9.3E-19 181 238
PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain) 4.2E-08 287 342

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P87058|LAH1_SCHPO La protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 172 402 2.0E-38
sp|P33399|LHP1_YEAST La protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHP1 PE=1 SV=2 183 352 1.0E-20
sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens GN=SSB PE=1 SV=2 181 366 6.0E-20
sp|P38656|LA_RAT Lupus La protein homolog OS=Rattus norvegicus GN=Ssb PE=1 SV=1 181 366 6.0E-20
sp|P10881|LA_BOVIN Lupus La protein homolog OS=Bos taurus GN=SSB PE=2 SV=2 181 366 1.0E-19
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P87058|LAH1_SCHPO La protein homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sla1 PE=1 SV=1 172 402 2.0E-38
sp|P33399|LHP1_YEAST La protein homolog OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LHP1 PE=1 SV=2 183 352 1.0E-20
sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens GN=SSB PE=1 SV=2 181 366 6.0E-20
sp|P38656|LA_RAT Lupus La protein homolog OS=Rattus norvegicus GN=Ssb PE=1 SV=1 181 366 6.0E-20
sp|P10881|LA_BOVIN Lupus La protein homolog OS=Bos taurus GN=SSB PE=2 SV=2 181 366 1.0E-19
sp|P32067|LA_MOUSE Lupus La protein homolog OS=Mus musculus GN=Ssb PE=1 SV=1 181 366 2.0E-19
sp|P40796|LA_DROME La protein homolog OS=Drosophila melanogaster GN=La PE=1 SV=2 180 358 1.0E-16
sp|P28049|LAB_XENLA Lupus La protein homolog B OS=Xenopus laevis GN=ssb-b PE=2 SV=1 172 358 2.0E-15
sp|P28048|LAA_XENLA Lupus La protein homolog A OS=Xenopus laevis GN=ssb-a PE=2 SV=1 175 358 1.0E-14
sp|Q26457|LA_AEDAL La protein homolog OS=Aedes albopictus PE=1 SV=1 183 355 3.0E-14
sp|Q94A38|LRP6A_ARATH La-related protein 6A OS=Arabidopsis thaliana GN=LARP6A PE=2 SV=1 181 448 4.0E-14
sp|Q93ZV7|LA1_ARATH La protein 1 OS=Arabidopsis thaliana GN=LA1 PE=1 SV=1 181 356 9.0E-10
sp|Q7ZWE3|LARP7_DANRE La-related protein 7 OS=Danio rerio GN=larp7 PE=2 SV=1 163 337 1.0E-09
sp|Q28G87|LARP7_XENTR La-related protein 7 OS=Xenopus tropicalis GN=larp7 PE=2 SV=1 181 337 9.0E-09
sp|Q0V7U7|LA2_ARATH La protein 2 OS=Arabidopsis thaliana GN=LA2 PE=1 SV=1 181 413 9.0E-08
sp|Q05CL8|LARP7_MOUSE La-related protein 7 OS=Mus musculus GN=Larp7 PE=1 SV=2 171 337 1.0E-07
sp|Q5XI01|LARP7_RAT La-related protein 7 OS=Rattus norvegicus GN=Larp7 PE=1 SV=2 171 337 2.0E-07
sp|Q4G0J3|LARP7_HUMAN La-related protein 7 OS=Homo sapiens GN=LARP7 PE=1 SV=1 171 337 3.0E-07
sp|Q4R627|LARP7_MACFA La-related protein 7 OS=Macaca fascicularis GN=LARP7 PE=2 SV=1 171 337 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0097159 organic cyclic compound binding No
GO:0003674 molecular_function No
GO:0003676 nucleic acid binding No
GO:1901363 heterocyclic compound binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5802
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|5637
Ophiocordyceps australis map64 (Brazil) OphauB2|7310
Ophiocordyceps camponoti-floridani Ophcf2|04229
Ophiocordyceps camponoti-rufipedis Ophun1|6624 (this protein)
Ophiocordyceps kimflemingae Ophio5|2393
Ophiocordyceps subramaniannii Hirsu2|990

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6624
MSEPETTAKPAEADRSSSTVADEHSQLESEKPQSVKTEPDLEEKMQQTIKAEPGSEDGNLQTIKADPGLEEEKRQ
FIKAEPDSEEGKPQSIKAEPEVEDKKTQSAIESEDAKEKTVEPTPIAASTEQSKSKEEPAGTAPDVTTAPEVTTT
ETKTPTDRSVYQNNRKFDPSVREVTDDPVAIRKQVEFYFGDWNFPQDKFMWESCGGTANKPMPISKIHSFKRMRT
FQPYSAIVAALRESSFLEVVGDEGQEMVKRKVGYKPMAEARAKAEAATVYAKGFGDENPDTQFDLESFFGKYGEI
KGLKLRRTNEGLFKGSVFVTFPDVDAAKKFVDLKPAPTYKGNDLKIMLKRDYCDEKSELIRQGKLEPSNNGLRKK
FFEGKDSTRRGSRDNRQPGGDDWKKRREQDQKNGFQDRRDGGRGRGARGRDRGRGRGRGGGRGGRDGAGRGRGGR
DGGDRRDNTNDVKPPRIQSTADESSAGPATAGSKRARDEAGAPDEAPAAKKVDIKEEIKTEET*
Coding >Ophun1|6624
ATGAGCGAGCCTGAGACCACCGCGAAGCCCGCAGAGGCAGATCGATCGTCTTCAACCGTGGCCGATGAACACTCT
CAGCTCGAGAGCGAGAAGCCCCAGTCCGTCAAAACTGAGCCTGATCTCGAGGAGAAGATGCAACAGACCATCAAA
GCTGAACCTGGTTCTGAAGATGGAAATCTTCAGACCATCAAAGCTGATCCTGGATTGGAAGAGGAGAAGCGTCAG
TTCATCAAAGCTGAGCCCGATTCCGAAGAGGGGAAGCCTCAATCTATCAAAGCCGAGCCTGAAGTCGAGGATAAG
AAGACGCAGTCCGCCATTGAGTCTGAGGACGCCAAGGAGAAAACTGTTGAGCCTACGCCCATCGCTGCCTCAACA
GAGCAGTCCAAGTCGAAAGAAGAGCCTGCTGGCACTGCTCCAGACGTGACCACTGCACCCGAAGTCACAACCACC
GAGACGAAAACGCCCACGGACCGTTCAGTCTACCAAAACAACCGAAAGTTTGACCCGAGCGTCCGCGAGGTCACC
GATGACCCAGTCGCTATCCGCAAGCAGGTCGAGTTCTACTTTGGAGACTGGAATTTTCCCCAGGACAAGTTCATG
TGGGAATCCTGCGGAGGAACAGCCAACAAGCCCATGCCCATCTCCAAAATTCACTCCTTCAAGCGCATGCGCACA
TTTCAGCCTTACAGCGCCATCGTTGCCGCCTTGCGCGAGAGCAGCTTTCTAGAGGTGGTGGGCGACGAAGGGCAA
GAGATGGTCAAGCGCAAGGTCGGCTACAAGCCCATGGCCGAAGCGCGGGCCAAGGCTGAGGCCGCCACGGTCTAC
GCCAAAGGCTTCGGTGACGAGAACCCCGACACTCAGTTCGATCTTGAGAGTTTCTTTGGAAAATACGGCGAGATC
AAGGGTCTCAAGTTACGCCGGACAAACGAGGGGCTGTTCAAGGGCTCCGTCTTCGTCACATTTCCCGACGTGGAC
GCAGCAAAGAAGTTTGTCGACTTGAAGCCTGCTCCGACCTACAAGGGAAACGATTTGAAGATCATGCTCAAGCGG
GACTACTGCGACGAGAAGAGCGAGCTCATCCGCCAGGGTAAGCTCGAGCCTAGTAACAATGGACTGCGCAAGAAG
TTCTTTGAAGGCAAGGACTCCACACGGAGAGGATCGCGAGACAACCGTCAGCCGGGGGGTGACGATTGGAAGAAG
CGGCGCGAGCAAGACCAGAAAAATGGCTTCCAGGACCGACGCGACGGCGGCCGCGGACGAGGTGCACGGGGTCGA
GACCGTGGCCGTGGCCGGGGCCGAGGTGGAGGTCGCGGAGGCCGTGACGGTGCCGGCAGGGGCCGCGGAGGCCGC
GACGGGGGTGATCGTCGCGACAACACCAATGATGTCAAGCCTCCTCGCATCCAATCCACGGCAGACGAGAGCAGC
GCAGGGCCGGCTACTGCTGGCAGCAAGCGAGCCCGAGACGAAGCCGGCGCCCCGGACGAAGCCCCCGCGGCGAAA
AAGGTCGATATCAAAGAAGAGATCAAGACGGAAGAGACTTAG
Transcript >Ophun1|6624
ATGAGCGAGCCTGAGACCACCGCGAAGCCCGCAGAGGCAGATCGATCGTCTTCAACCGTGGCCGATGAACACTCT
CAGCTCGAGAGCGAGAAGCCCCAGTCCGTCAAAACTGAGCCTGATCTCGAGGAGAAGATGCAACAGACCATCAAA
GCTGAACCTGGTTCTGAAGATGGAAATCTTCAGACCATCAAAGCTGATCCTGGATTGGAAGAGGAGAAGCGTCAG
TTCATCAAAGCTGAGCCCGATTCCGAAGAGGGGAAGCCTCAATCTATCAAAGCCGAGCCTGAAGTCGAGGATAAG
AAGACGCAGTCCGCCATTGAGTCTGAGGACGCCAAGGAGAAAACTGTTGAGCCTACGCCCATCGCTGCCTCAACA
GAGCAGTCCAAGTCGAAAGAAGAGCCTGCTGGCACTGCTCCAGACGTGACCACTGCACCCGAAGTCACAACCACC
GAGACGAAAACGCCCACGGACCGTTCAGTCTACCAAAACAACCGAAAGTTTGACCCGAGCGTCCGCGAGGTCACC
GATGACCCAGTCGCTATCCGCAAGCAGGTCGAGTTCTACTTTGGAGACTGGAATTTTCCCCAGGACAAGTTCATG
TGGGAATCCTGCGGAGGAACAGCCAACAAGCCCATGCCCATCTCCAAAATTCACTCCTTCAAGCGCATGCGCACA
TTTCAGCCTTACAGCGCCATCGTTGCCGCCTTGCGCGAGAGCAGCTTTCTAGAGGTGGTGGGCGACGAAGGGCAA
GAGATGGTCAAGCGCAAGGTCGGCTACAAGCCCATGGCCGAAGCGCGGGCCAAGGCTGAGGCCGCCACGGTCTAC
GCCAAAGGCTTCGGTGACGAGAACCCCGACACTCAGTTCGATCTTGAGAGTTTCTTTGGAAAATACGGCGAGATC
AAGGGTCTCAAGTTACGCCGGACAAACGAGGGGCTGTTCAAGGGCTCCGTCTTCGTCACATTTCCCGACGTGGAC
GCAGCAAAGAAGTTTGTCGACTTGAAGCCTGCTCCGACCTACAAGGGAAACGATTTGAAGATCATGCTCAAGCGG
GACTACTGCGACGAGAAGAGCGAGCTCATCCGCCAGGGTAAGCTCGAGCCTAGTAACAATGGACTGCGCAAGAAG
TTCTTTGAAGGCAAGGACTCCACACGGAGAGGATCGCGAGACAACCGTCAGCCGGGGGGTGACGATTGGAAGAAG
CGGCGCGAGCAAGACCAGAAAAATGGCTTCCAGGACCGACGCGACGGCGGCCGCGGACGAGGTGCACGGGGTCGA
GACCGTGGCCGTGGCCGGGGCCGAGGTGGAGGTCGCGGAGGCCGTGACGGTGCCGGCAGGGGCCGCGGAGGCCGC
GACGGGGGTGATCGTCGCGACAACACCAATGATGTCAAGCCTCCTCGCATCCAATCCACGGCAGACGAGAGCAGC
GCAGGGCCGGCTACTGCTGGCAGCAAGCGAGCCCGAGACGAAGCCGGCGCCCCGGACGAAGCCCCCGCGGCGAAA
AAGGTCGATATCAAAGAAGAGATCAAGACGGAAGAGACTTAG
Gene >Ophun1|6624
ATGAGCGAGCCTGAGACCACCGCGAAGCCCGCAGAGGCAGATCGATCGTCTTCAACCGTGGCCGATGAACACTCT
CAGCTCGAGAGCGAGAAGCCCCAGTCCGTCAAAACTGAGCCTGATCTCGAGGAGAAGATGCAACAGACCATCAAA
GCTGAACCTGGTTCTGAAGATGGAAATCTTCAGACCATCAAAGCTGATCCTGGATTGGAAGAGGAGAAGCGTCAG
TTCATCAAAGCTGAGCCCGATTCCGAAGAGGGGAAGCCTCAATCTATCAAAGCCGAGCCTGAAGTCGAGGATAAG
AAGACGCAGTCCGCCATTGAGTCTGAGGACGCCAAGGAGAAAACTGTTGAGCCTACGCCCATCGCTGCCTCAACA
GAGCAGTCCAAGTCGAAAGAAGAGCCTGCTGGCACTGCTCCAGACGTGACCACTGCACCCGAAGTCACAACCACC
GAGACGAAAACGCCCACGGACCGTTCAGTCTACCAAAACAACCGAAAGTTTGACCCGAGCGTCCGCGAGGTCACC
GATGACCCAGTCGCTATCCGCAAGCAGGTACTGCTCACTGTCCGCTGCATCGATGCAGCTTTTCTTGGAGAGGAA
GAACAACCAACTAAAAGCTTTTTGCACAGGTCGAGTTCTACTTTGGAGACTGGAATTTTCCCCAGGACAAGTTCA
TGTGGGAATCCTGCGGAGGAACAGCCAACAAGCCCATGCCCATCTCCAAAATTCACTCCTTCAAGCGCATGCGCA
CATTTCAGCCTTACAGCGCCATCGTTGCCGCCTTGCGCGAGAGCAGCTTTCTAGAGGTGGTGGGCGACGAAGGGC
AAGAGATGGTCAAGCGCAAGGTCGGCTACAAGCCCATGGCCGAAGCGCGGGCCAAGGCTGAGGCCGCCACGGTCT
ACGCCAAAGGCTTCGGTGACGAGAACCCCGACACTCAGTTCGATCTTGAGAGTTTCTTTGGAAAATACGGCGAGA
TCAAGGGTCTCAAGTTACGCCGGACAAACGAGGGGCTGTTCAAGGGCTCCGTCTTCGTCACATTTCCCGACGTGG
ACGCAGCAAAGAAGTTTGTCGACTTGAAGCCTGCTCCGACCTACAAGGGAAACGATTTGAAGATCATGCTCAAGC
GGGACTACTGCGACGAGAAGAGCGAGCTCATCCGCCAGGGTAAGCTCGAGCCTAGTAACAATGGACTGCGCAAGA
AGTTCTTTGAAGGCAAGGACTCCACACGGAGAGGATCGCGAGACAACCGTCAGCCGGGGGGTGACGATTGGAAGA
AGCGGCGCGAGCAAGACCAGAAAAATGGCTTCCAGGACCGACGCGACGGCGGCCGCGGACGAGGTGCACGGGGTC
GAGACCGTGGCCGTGGCCGGGGCCGAGGTGGAGGTCGCGGAGGCCGTGACGGTGCCGGCAGGGGCCGCGGAGGCC
GCGACGGGGGTGATCGTCGCGACAACACCAATGAGTGAGTGGCGATGATGGCCGTGAATGGGACTCACTTGCTAA
CGTTGCTCGAAGTGTCAAGCCTCCTCGCATCCAATCCACGGCAGACGAGAGCAGCGCAGGGCCGGCTACTGCTGG
CAGCAAGCGAGCCCGAGACGAAGCCGGCGCCCCGGACGAAGCCCCCGCGGCGAAAAAGGTCGATATCAAAGAAGA
GATCAAGACGGAAGAGACTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail