Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6617
Gene name
LocationContig_738:4891..5986
Strand-
Gene length (bp)1095
Transcript length (bp)1095
Coding sequence length (bp)1095
Protein length (aa) 365

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF06330 TRI5 Trichodiene synthase (TRI5) 4.1E-113 10 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NID7|TRI5_FUSPS Trichodiene synthase OS=Fusarium pseudograminearum GN=TRI5 PE=3 SV=1 5 342 1.0E-77
sp|Q8NJA1|TRI5_FUSMI Trichodiene synthase OS=Fusarium mesoamericanum GN=TRI5 PE=3 SV=1 5 343 3.0E-77
sp|Q8NIH0|TRI5_FUSAU Trichodiene synthase OS=Fusarium austroamericanum GN=TRI5 PE=3 SV=1 5 343 3.0E-77
sp|Q8NIG9|TRI5_FUSCU Trichodiene synthase OS=Fusarium culmorum GN=TRI5 PE=3 SV=1 5 343 3.0E-77
sp|Q8NIC1|TRI5_FUSCE Trichodiene synthase OS=Fusarium cerealis GN=TRI5 PE=3 SV=1 5 342 3.0E-77
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q8NID7|TRI5_FUSPS Trichodiene synthase OS=Fusarium pseudograminearum GN=TRI5 PE=3 SV=1 5 342 1.0E-77
sp|Q8NJA1|TRI5_FUSMI Trichodiene synthase OS=Fusarium mesoamericanum GN=TRI5 PE=3 SV=1 5 343 3.0E-77
sp|Q8NIH0|TRI5_FUSAU Trichodiene synthase OS=Fusarium austroamericanum GN=TRI5 PE=3 SV=1 5 343 3.0E-77
sp|Q8NIG9|TRI5_FUSCU Trichodiene synthase OS=Fusarium culmorum GN=TRI5 PE=3 SV=1 5 343 3.0E-77
sp|Q8NIC1|TRI5_FUSCE Trichodiene synthase OS=Fusarium cerealis GN=TRI5 PE=3 SV=1 5 342 3.0E-77
sp|Q8NIC8|TRI5_FUSME Trichodiene synthase OS=Fusarium meridionale GN=TRI5 PE=3 SV=1 5 342 3.0E-77
sp|Q7LJF8|TRI5_FUSCO Trichodiene synthase OS=Fusarium cortaderiae GN=TRI5 PE=3 SV=1 5 342 3.0E-77
sp|Q8NIH6|TRI5_FUSAS Trichodiene synthase OS=Fusarium asiaticum GN=TRI5 PE=3 SV=1 5 343 3.0E-77
sp|Q8NIH3|TRI5_FUSBO Trichodiene synthase OS=Fusarium boothii GN=TRI5 PE=3 SV=1 5 343 6.0E-77
sp|O59947|TRI5_STACH Trichodiene synthase OS=Stachybotrys chartarum GN=TRI5 PE=3 SV=1 19 359 8.0E-77
sp|Q7LJR6|TRI5_FUSAC Trichodiene synthase OS=Fusarium acaciae-mearnsii GN=TRI5 PE=3 SV=1 5 343 9.0E-77
sp|Q00909|TRI5_GIBZE Trichodiene synthase OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TRI5 PE=3 SV=2 5 343 1.0E-76
sp|P13513|TRI5_FUSSP Trichodiene synthase OS=Fusarium sporotrichioides GN=TRI5 PE=1 SV=1 5 342 4.0E-76
sp|P27679|TRI5_GIBPU Trichodiene synthase OS=Gibberella pulicaris GN=TRI5 PE=3 SV=1 5 342 2.0E-75
sp|Q6A1B7|TRI5_TRIHA Trichodiene synthase OS=Trichoderma harzianum GN=TRI5 PE=3 SV=1 11 342 5.0E-75
sp|Q00835|TRI5_FUSPO Trichodiene synthase OS=Fusarium poae GN=TRI5 PE=3 SV=1 5 342 5.0E-75
sp|O13489|TRI5_MYRRO Trichodiene synthase OS=Myrothecium roridum GN=TRI5 PE=3 SV=1 1 361 3.0E-72
[Show less]

GO

GO Term Description Terminal node
GO:0016838 carbon-oxygen lyase activity, acting on phosphates Yes
GO:0016835 carbon-oxygen lyase activity No
GO:0003674 molecular_function No
GO:0016829 lyase activity No
GO:0003824 catalytic activity No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup162
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|816
Ophiocordyceps australis map64 (Brazil) OphauB2|4590
Ophiocordyceps camponoti-floridani Ophcf2|00789
Ophiocordyceps camponoti-floridani Ophcf2|00790
Ophiocordyceps camponoti-rufipedis Ophun1|5268
Ophiocordyceps camponoti-rufipedis Ophun1|5269
Ophiocordyceps camponoti-rufipedis Ophun1|6617 (this protein)
Ophiocordyceps kimflemingae Ophio5|2844
Ophiocordyceps kimflemingae Ophio5|3574
Ophiocordyceps kimflemingae Ophio5|3575
Ophiocordyceps subramaniannii Hirsu2|1178

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6617
MDTFNSHSTLYISSLRQYLDTIQYHDTNYSREERLAALQHIYSETIKHLPLLPPGIPPKTLQHVIQTSTQIVVCC
WSKLPPPIMVDLSIYFVLLILLDDDGFESSGHESWDAAGDLLAGGQKRNVFWAAMAPHLGNFVRHYGGFCGLAIL
RSTLDFYTGCWVEKGGFGGFAGSLSFPWFLRNLNGLGDVSSVTMFPACMYDEETILNEITTVMAELTPSIVLVND
LFSFYKECGRDEAPNFIANRCKTEGLSLEDSLRSLTAETCESTARVLSVLKGRDAGVYDAVRGFVQGYVTWHICD
DRYRLHELYDCCGEGSDEGRFREYFEEATAIGRFDVDEWAVPRDGIRNGESGGREAMARMGGKL*
Coding >Ophun1|6617
ATGGACACCTTCAACTCCCACTCAACCCTCTACATCTCCTCTCTCCGCCAATATCTCGACACAATCCAATACCAC
GACACAAACTACAGCCGAGAAGAACGTCTCGCCGCTCTCCAACACATCTACAGCGAAACAATCAAACACTTACCC
CTCTTGCCCCCGGGAATCCCGCCAAAGACACTTCAGCATGTCATCCAAACGAGCACCCAGATCGTCGTCTGCTGC
TGGTCGAAGCTGCCCCCGCCCATAATGGTAGATCTAAGCATCTACTTTGTCCTCCTCATCTTACTCGACGACGAT
GGCTTCGAAAGTTCGGGGCACGAGTCGTGGGATGCTGCGGGGGATCTGCTCGCGGGAGGACAGAAGCGGAATGTT
TTTTGGGCGGCTATGGCTCCCCATCTTGGAAACTTCGTACGACACTATGGGGGGTTCTGCGGTCTTGCCATCTTA
AGATCGACGTTGGATTTCTATACTGGTTGCTGGGTTGAGAAGGGGGGGTTTGGGGGCTTTGCTGGTTCGCTCTCT
TTTCCTTGGTTTCTGCGGAATCTCAATGGGTTGGGCGACGTTAGCAGTGTCACCATGTTTCCTGCTTGCATGTAC
GATGAGGAAACCATTCTCAACGAGATTACAACCGTCATGGCCGAACTAACACCTTCCATCGTCCTCGTCAACGAC
CTGTTTTCCTTTTACAAAGAATGCGGTCGCGACGAAGCCCCCAACTTTATAGCCAACCGCTGCAAAACCGAGGGC
CTCTCCCTTGAAGATTCTCTACGGAGTTTGACAGCAGAGACGTGCGAGTCTACAGCTCGCGTTCTCAGTGTGCTG
AAAGGGAGAGATGCTGGGGTCTATGATGCGGTGCGGGGCTTTGTTCAGGGGTATGTGACGTGGCATATATGCGAT
GACCGCTACCGGCTGCACGAGTTGTATGATTGCTGCGGAGAGGGTTCTGATGAGGGTAGGTTTCGAGAGTACTTT
GAGGAGGCGACGGCCATTGGGCGCTTTGATGTTGATGAATGGGCTGTGCCGCGAGATGGCATCCGGAATGGGGAG
TCGGGAGGGAGAGAGGCTATGGCACGGATGGGAGGGAAACTGTAG
Transcript >Ophun1|6617
ATGGACACCTTCAACTCCCACTCAACCCTCTACATCTCCTCTCTCCGCCAATATCTCGACACAATCCAATACCAC
GACACAAACTACAGCCGAGAAGAACGTCTCGCCGCTCTCCAACACATCTACAGCGAAACAATCAAACACTTACCC
CTCTTGCCCCCGGGAATCCCGCCAAAGACACTTCAGCATGTCATCCAAACGAGCACCCAGATCGTCGTCTGCTGC
TGGTCGAAGCTGCCCCCGCCCATAATGGTAGATCTAAGCATCTACTTTGTCCTCCTCATCTTACTCGACGACGAT
GGCTTCGAAAGTTCGGGGCACGAGTCGTGGGATGCTGCGGGGGATCTGCTCGCGGGAGGACAGAAGCGGAATGTT
TTTTGGGCGGCTATGGCTCCCCATCTTGGAAACTTCGTACGACACTATGGGGGGTTCTGCGGTCTTGCCATCTTA
AGATCGACGTTGGATTTCTATACTGGTTGCTGGGTTGAGAAGGGGGGGTTTGGGGGCTTTGCTGGTTCGCTCTCT
TTTCCTTGGTTTCTGCGGAATCTCAATGGGTTGGGCGACGTTAGCAGTGTCACCATGTTTCCTGCTTGCATGTAC
GATGAGGAAACCATTCTCAACGAGATTACAACCGTCATGGCCGAACTAACACCTTCCATCGTCCTCGTCAACGAC
CTGTTTTCCTTTTACAAAGAATGCGGTCGCGACGAAGCCCCCAACTTTATAGCCAACCGCTGCAAAACCGAGGGC
CTCTCCCTTGAAGATTCTCTACGGAGTTTGACAGCAGAGACGTGCGAGTCTACAGCTCGCGTTCTCAGTGTGCTG
AAAGGGAGAGATGCTGGGGTCTATGATGCGGTGCGGGGCTTTGTTCAGGGGTATGTGACGTGGCATATATGCGAT
GACCGCTACCGGCTGCACGAGTTGTATGATTGCTGCGGAGAGGGTTCTGATGAGGGTAGGTTTCGAGAGTACTTT
GAGGAGGCGACGGCCATTGGGCGCTTTGATGTTGATGAATGGGCTGTGCCGCGAGATGGCATCCGGAATGGGGAG
TCGGGAGGGAGAGAGGCTATGGCACGGATGGGAGGGAAACTGTAG
Gene >Ophun1|6617
ATGGACACCTTCAACTCCCACTCAACCCTCTACATCTCCTCTCTCCGCCAATATCTCGACACAATCCAATACCAC
GACACAAACTACAGCCGAGAAGAACGTCTCGCCGCTCTCCAACACATCTACAGCGAAACAATCAAACACTTACCC
CTCTTGCCCCCGGGAATCCCGCCAAAGACACTTCAGCATGTCATCCAAACGAGCACCCAGATCGTCGTCTGCTGC
TGGTCGAAGCTGCCCCCGCCCATAATGGTAGATCTAAGCATCTACTTTGTCCTCCTCATCTTACTCGACGACGAT
GGCTTCGAAAGTTCGGGGCACGAGTCGTGGGATGCTGCGGGGGATCTGCTCGCGGGAGGACAGAAGCGGAATGTT
TTTTGGGCGGCTATGGCTCCCCATCTTGGAAACTTCGTACGACACTATGGGGGGTTCTGCGGTCTTGCCATCTTA
AGATCGACGTTGGATTTCTATACTGGTTGCTGGGTTGAGAAGGGGGGGTTTGGGGGCTTTGCTGGTTCGCTCTCT
TTTCCTTGGTTTCTGCGGAATCTCAATGGGTTGGGCGACGTTAGCAGTGTCACCATGTTTCCTGCTTGCATGTAC
GATGAGGAAACCATTCTCAACGAGATTACAACCGTCATGGCCGAACTAACACCTTCCATCGTCCTCGTCAACGAC
CTGTTTTCCTTTTACAAAGAATGCGGTCGCGACGAAGCCCCCAACTTTATAGCCAACCGCTGCAAAACCGAGGGC
CTCTCCCTTGAAGATTCTCTACGGAGTTTGACAGCAGAGACGTGCGAGTCTACAGCTCGCGTTCTCAGTGTGCTG
AAAGGGAGAGATGCTGGGGTCTATGATGCGGTGCGGGGCTTTGTTCAGGGGTATGTGACGTGGCATATATGCGAT
GACCGCTACCGGCTGCACGAGTTGTATGATTGCTGCGGAGAGGGTTCTGATGAGGGTAGGTTTCGAGAGTACTTT
GAGGAGGCGACGGCCATTGGGCGCTTTGATGTTGATGAATGGGCTGTGCCGCGAGATGGCATCCGGAATGGGGAG
TCGGGAGGGAGAGAGGCTATGGCACGGATGGGAGGGAAACTGTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail