Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6614
Gene name
LocationContig_737:2768..4638
Strand+
Gene length (bp)1870
Transcript length (bp)1494
Coding sequence length (bp)1494
Protein length (aa) 498

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00443 UCH Ubiquitin carboxyl-terminal hydrolase 6.0E-35 181 491
PF13423 UCH_1 Ubiquitin carboxyl-terminal hydrolase 2.7E-05 184 353
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 6.9E-05 79 129

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 21 496 2.0E-51
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 84 491 1.0E-44
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 99 491 7.0E-44
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 98 491 1.0E-43
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 98 491 2.0E-43
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09738|UBP8_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp8 PE=3 SV=1 21 496 2.0E-51
sp|A6H8I0|UBP22_DANRE Ubiquitin carboxyl-terminal hydrolase 22 OS=Danio rerio GN=usp22 PE=2 SV=1 84 491 1.0E-44
sp|Q5DU02|UBP22_MOUSE Ubiquitin carboxyl-terminal hydrolase 22 OS=Mus musculus GN=Usp22 PE=2 SV=2 99 491 7.0E-44
sp|Q9UPT9|UBP22_HUMAN Ubiquitin carboxyl-terminal hydrolase 22 OS=Homo sapiens GN=USP22 PE=1 SV=2 98 491 1.0E-43
sp|P0C8Z3|UBP22_BOVIN Ubiquitin carboxyl-terminal hydrolase 22 OS=Bos taurus GN=USP22 PE=2 SV=1 98 491 2.0E-43
sp|Q6DCJ1|UB22B_XENLA Ubiquitin carboxyl-terminal hydrolase 22-B OS=Xenopus laevis GN=usp22-b PE=2 SV=2 98 491 8.0E-42
sp|P50102|UBP8_YEAST Ubiquitin carboxyl-terminal hydrolase 8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP8 PE=1 SV=1 80 496 1.0E-41
sp|Q6GNI6|UB22A_XENLA Ubiquitin carboxyl-terminal hydrolase 22-A OS=Xenopus laevis GN=usp22-a PE=2 SV=1 98 491 1.0E-41
sp|Q70EK9|UBP51_HUMAN Ubiquitin carboxyl-terminal hydrolase 51 OS=Homo sapiens GN=USP51 PE=2 SV=1 22 491 8.0E-40
sp|Q8CEG8|UBP27_MOUSE Ubiquitin carboxyl-terminal hydrolase 27 OS=Mus musculus GN=Usp27 PE=2 SV=2 172 491 6.0E-38
sp|A6NNY8|UBP27_HUMAN Ubiquitin carboxyl-terminal hydrolase 27 OS=Homo sapiens GN=USP27X PE=2 SV=3 178 491 8.0E-38
sp|Q9VVR1|NOT_DROME Ubiquitin carboxyl-terminal hydrolase nonstop OS=Drosophila melanogaster GN=not PE=1 SV=3 82 491 3.0E-35
sp|Q9LEW0|UBP22_ARATH Ubiquitin carboxyl-terminal hydrolase 22 OS=Arabidopsis thaliana GN=UBP22 PE=2 SV=1 82 491 6.0E-35
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 102 492 1.0E-20
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 96 494 4.0E-19
sp|Q6R6M4|U17L2_HUMAN Ubiquitin carboxyl-terminal hydrolase 17 OS=Homo sapiens GN=USP17L2 PE=1 SV=2 181 495 1.0E-17
sp|Q7M764|U17PE_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein E OS=Mus musculus GN=Usp17le PE=3 SV=2 181 492 2.0E-17
sp|D6RBQ6|U17LH_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 17 OS=Homo sapiens GN=USP17L17 PE=3 SV=1 181 495 1.0E-16
sp|Q6QN14|U17L6_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 6 OS=Homo sapiens GN=USP17L6P PE=1 SV=2 181 495 2.0E-16
sp|C9JLJ4|U17LD_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 13 OS=Homo sapiens GN=USP17L13 PE=3 SV=1 181 495 2.0E-16
sp|A8MUK1|U17L5_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 5 OS=Homo sapiens GN=USP17L5 PE=3 SV=2 181 495 2.0E-16
sp|C9JJH3|U17LA_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 10 OS=Homo sapiens GN=USP17L10 PE=3 SV=1 181 495 2.0E-16
sp|A6NCW7|U17L4_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 4 OS=Homo sapiens GN=USP17L4 PE=3 SV=3 181 495 3.0E-16
sp|P0C7I0|U17L8_HUMAN Inactive ubiquitin carboxyl-terminal hydrolase 17-like protein 8 OS=Homo sapiens GN=USP17L8 PE=3 SV=1 181 495 4.0E-16
sp|D6RJB6|U17LK_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 20 OS=Homo sapiens GN=USP17L20 PE=3 SV=1 181 495 4.0E-16
sp|Q0WX57|U17LO_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 24 OS=Homo sapiens GN=USP17L24 PE=1 SV=2 181 495 4.0E-16
sp|D6RA61|U17LM_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 22 OS=Homo sapiens GN=USP17L22 PE=3 SV=1 181 495 4.0E-16
sp|Q61068|U17PA_MOUSE Ubiquitin carboxyl-terminal hydrolase 17-like protein A OS=Mus musculus GN=Usp17la PE=1 SV=1 181 492 5.0E-16
sp|D6R9N7|U17LI_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 18 OS=Homo sapiens GN=USP17L18 PE=3 SV=1 181 495 5.0E-16
sp|C9JVI0|U17LB_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 11 OS=Homo sapiens GN=USP17L11 PE=3 SV=1 181 495 5.0E-16
sp|D6RCP7|U17LJ_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 19 OS=Homo sapiens GN=USP17L19 PE=3 SV=1 181 495 5.0E-16
sp|Q7RTZ2|U17L1_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 1 OS=Homo sapiens GN=USP17L1 PE=3 SV=1 181 495 5.0E-16
sp|A6NCW0|U17L3_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 3 OS=Homo sapiens GN=USP17L3 PE=3 SV=1 181 495 6.0E-16
sp|D6R901|U17LL_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 21 OS=Homo sapiens GN=USP17L21 PE=3 SV=1 181 495 9.0E-16
sp|Q9P275|UBP36_HUMAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Homo sapiens GN=USP36 PE=1 SV=3 181 492 9.0E-16
sp|C9J2P7|U17LF_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 15 OS=Homo sapiens GN=USP17L15 PE=3 SV=1 181 495 1.0E-15
sp|C9JPN9|UL17C_HUMAN Ubiquitin carboxyl-terminal hydrolase 17-like protein 12 OS=Homo sapiens GN=USP17L12 PE=3 SV=1 181 495 1.0E-15
sp|B1AQJ2|UBP36_MOUSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Mus musculus GN=Usp36 PE=1 SV=1 181 492 2.0E-15
sp|D3ZU96|UBP42_RAT Ubiquitin carboxyl-terminal hydrolase 42 OS=Rattus norvegicus GN=Usp42 PE=1 SV=1 181 492 3.0E-15
sp|B2RQC2|UBP42_MOUSE Ubiquitin carboxyl-terminal hydrolase 42 OS=Mus musculus GN=Usp42 PE=1 SV=1 181 492 3.0E-15
sp|O74442|UBP16_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 16 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp16 PE=1 SV=1 181 497 4.0E-15
sp|Q9H9J4|UBP42_HUMAN Ubiquitin carboxyl-terminal hydrolase 42 OS=Homo sapiens GN=USP42 PE=1 SV=3 181 492 1.0E-14
sp|Q9SB51|UBP16_ARATH Ubiquitin carboxyl-terminal hydrolase 16 OS=Arabidopsis thaliana GN=UBP16 PE=1 SV=1 181 491 1.0E-14
sp|E1B9W9|UBP42_BOVIN Ubiquitin carboxyl-terminal hydrolase 42 OS=Bos taurus GN=USP42 PE=3 SV=1 181 492 2.0E-14
sp|Q9UPU5|UBP24_HUMAN Ubiquitin carboxyl-terminal hydrolase 24 OS=Homo sapiens GN=USP24 PE=1 SV=3 176 425 2.0E-13
sp|B1AY13|UBP24_MOUSE Ubiquitin carboxyl-terminal hydrolase 24 OS=Mus musculus GN=Usp24 PE=1 SV=1 176 425 2.0E-13
sp|Q67XW5|UBP18_ARATH Ubiquitin carboxyl-terminal hydrolase 18 OS=Arabidopsis thaliana GN=UBP18 PE=2 SV=2 181 491 5.0E-13
sp|Q9FPS9|UBP15_ARATH Ubiquitin carboxyl-terminal hydrolase 15 OS=Arabidopsis thaliana GN=UBP15 PE=2 SV=2 180 492 9.0E-13
sp|O75604|UBP2_HUMAN Ubiquitin carboxyl-terminal hydrolase 2 OS=Homo sapiens GN=USP2 PE=1 SV=2 176 495 2.0E-12
sp|Q9UTT1|UBP21_SCHPO Ubiquitin carboxyl-terminal hydrolase 21 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp21 PE=3 SV=2 173 482 2.0E-12
sp|Q5U349|UBP2_RAT Ubiquitin carboxyl-terminal hydrolase 2 OS=Rattus norvegicus GN=Usp2 PE=1 SV=1 176 495 3.0E-12
sp|Q9SJA1|UBP19_ARATH Ubiquitin carboxyl-terminal hydrolase 19 OS=Arabidopsis thaliana GN=UBP19 PE=2 SV=2 181 491 3.0E-12
sp|O00507|USP9Y_HUMAN Probable ubiquitin carboxyl-terminal hydrolase FAF-Y OS=Homo sapiens GN=USP9Y PE=2 SV=2 178 450 4.0E-12
sp|Q6P8X6|UBP50_MOUSE Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Mus musculus GN=Usp50 PE=2 SV=1 177 491 5.0E-12
sp|O88623|UBP2_MOUSE Ubiquitin carboxyl-terminal hydrolase 2 OS=Mus musculus GN=Usp2 PE=1 SV=2 176 495 5.0E-12
sp|O57429|UBP2_CHICK Ubiquitin carboxyl-terminal hydrolase 2 OS=Gallus gallus GN=USP2 PE=2 SV=1 167 495 1.0E-11
sp|Q5RBQ4|UBP46_PONAB Ubiquitin carboxyl-terminal hydrolase 46 OS=Pongo abelii GN=USP46 PE=2 SV=1 181 494 1.0E-11
sp|P62069|UBP46_MOUSE Ubiquitin carboxyl-terminal hydrolase 46 OS=Mus musculus GN=Usp46 PE=1 SV=1 181 494 1.0E-11
sp|P62068|UBP46_HUMAN Ubiquitin carboxyl-terminal hydrolase 46 OS=Homo sapiens GN=USP46 PE=1 SV=1 181 494 1.0E-11
sp|Q4R6D3|UBP50_MACFA Putative ubiquitin carboxyl-terminal hydrolase 50 OS=Macaca fascicularis GN=USP50 PE=2 SV=1 176 491 3.0E-11
sp|Q2KHV7|UBP2_BOVIN Ubiquitin carboxyl-terminal hydrolase 2 OS=Bos taurus GN=USP2 PE=2 SV=1 176 495 7.0E-11
sp|Q9FPS2|UBP25_ARATH Ubiquitin carboxyl-terminal hydrolase 25 OS=Arabidopsis thaliana GN=UBP25 PE=2 SV=1 181 491 2.0E-10
sp|A5WWB0|UBP46_DANRE Ubiquitin carboxyl-terminal hydrolase 46 OS=Danio rerio GN=usp46 PE=3 SV=2 181 491 2.0E-10
sp|Q9FIQ1|UBP21_ARATH Ubiquitin carboxyl-terminal hydrolase 21 OS=Arabidopsis thaliana GN=UBP21 PE=2 SV=1 181 491 3.0E-10
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 304 494 9.0E-10
sp|Q9FPS4|UBP23_ARATH Ubiquitin carboxyl-terminal hydrolase 23 OS=Arabidopsis thaliana GN=UBP23 PE=2 SV=2 181 492 1.0E-09
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 304 494 1.0E-09
sp|A5D9H7|UBP12_BOVIN Ubiquitin carboxyl-terminal hydrolase 12 OS=Bos taurus GN=USP12 PE=2 SV=1 181 415 2.0E-09
sp|Q80U87|UBP8_MOUSE Ubiquitin carboxyl-terminal hydrolase 8 OS=Mus musculus GN=Usp8 PE=1 SV=2 178 491 2.0E-09
sp|Q8LAM0|UBP4_ARATH Ubiquitin carboxyl-terminal hydrolase 4 OS=Arabidopsis thaliana GN=UBP4 PE=1 SV=2 181 481 2.0E-09
sp|P40818|UBP8_HUMAN Ubiquitin carboxyl-terminal hydrolase 8 OS=Homo sapiens GN=USP8 PE=1 SV=1 178 491 4.0E-09
sp|Q5M981|UB12B_XENLA Ubiquitin carboxyl-terminal hydrolase 12-B OS=Xenopus laevis GN=usp12-b PE=2 SV=2 181 415 1.0E-08
sp|Q52KZ6|UB12A_XENLA Ubiquitin carboxyl-terminal hydrolase 12-A OS=Xenopus laevis GN=usp12-a PE=2 SV=1 181 415 2.0E-08
sp|Q9D9M2|UBP12_MOUSE Ubiquitin carboxyl-terminal hydrolase 12 OS=Mus musculus GN=Usp12 PE=2 SV=2 181 415 2.0E-08
sp|B3M3M6|UBP36_DROAN Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila ananassae GN=Usp36 PE=3 SV=1 181 339 2.0E-08
sp|O75317|UBP12_HUMAN Ubiquitin carboxyl-terminal hydrolase 12 OS=Homo sapiens GN=USP12 PE=1 SV=2 181 415 2.0E-08
sp|P55824|FAF_DROME Probable ubiquitin carboxyl-terminal hydrolase FAF OS=Drosophila melanogaster GN=faf PE=1 SV=2 178 473 6.0E-08
sp|B4QIS3|UBP36_DROSI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila simulans GN=Usp36 PE=3 SV=1 181 491 7.0E-08
sp|Q2LZB1|UBP36_DROPS Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila pseudoobscura pseudoobscura GN=Usp36 PE=3 SV=2 181 337 1.0E-07
sp|O24454|UBP3_ARATH Ubiquitin carboxyl-terminal hydrolase 3 OS=Arabidopsis thaliana GN=UBP3 PE=1 SV=1 181 491 1.0E-07
sp|Q7JKC3|UBP7_CAEEL Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis elegans GN=usp-7 PE=3 SV=1 167 492 1.0E-07
sp|B4LG38|UBP36_DROVI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila virilis GN=Usp36 PE=3 SV=1 181 339 2.0E-07
sp|B4HUI5|UBP36_DROSE Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila sechellia GN=Usp36 PE=3 SV=1 181 337 2.0E-07
sp|C0HB46|UBP12_SALSA Ubiquitin carboxyl-terminal hydrolase 12 OS=Salmo salar GN=usp12 PE=2 SV=1 181 494 2.0E-07
sp|B4KXJ5|UBP36_DROMO Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila mojavensis GN=Usp36 PE=3 SV=1 181 339 2.0E-07
sp|A4FUN7|UBP12_DANRE Ubiquitin carboxyl-terminal hydrolase 12A OS=Danio rerio GN=usp12a PE=2 SV=1 181 494 3.0E-07
sp|B4PIW8|UBP36_DROYA Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila yakuba GN=Usp36 PE=3 SV=1 181 339 3.0E-07
sp|B3NC86|UBP36_DROER Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila erecta GN=Usp36 PE=3 SV=1 181 491 4.0E-07
sp|B4IXE0|UBP36_DROGR Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila grimshawi GN=Usp36 PE=3 SV=1 181 339 4.0E-07
sp|Q9P7V9|UBP9_SCHPO Probable ubiquitin carboxyl-terminal hydrolase 9 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ubp9 PE=1 SV=1 262 397 4.0E-07
sp|P38187|UBP13_YEAST Ubiquitin carboxyl-terminal hydrolase 13 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=UBP13 PE=1 SV=3 266 491 4.0E-07
sp|Q9FKP5|UBP17_ARATH Ubiquitin carboxyl-terminal hydrolase 17 OS=Arabidopsis thaliana GN=UBP17 PE=2 SV=1 181 491 8.0E-07
sp|B4MLR8|UBP36_DROWI Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila willistoni GN=Usp36 PE=3 SV=1 181 491 1.0E-06
sp|Q9NVE5|UBP40_HUMAN Ubiquitin carboxyl-terminal hydrolase 40 OS=Homo sapiens GN=USP40 PE=1 SV=3 179 442 2.0E-06
sp|Q60MK8|UBP7_CAEBR Ubiquitin carboxyl-terminal hydrolase 7 OS=Caenorhabditis briggsae GN=usp-7 PE=3 SV=1 167 492 3.0E-06
sp|Q9VRP5|UBP36_DROME Ubiquitin carboxyl-terminal hydrolase 36 OS=Drosophila melanogaster GN=scny PE=1 SV=3 181 491 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0004843 cysteine-type deubiquitinase activity Yes
GO:0016579 protein deubiquitination Yes
GO:0070647 protein modification by small protein conjugation or removal No
GO:0046914 transition metal ion binding No
GO:0044238 primary metabolic process No
GO:0003824 catalytic activity No
GO:0008152 metabolic process No
GO:0046872 metal ion binding No
GO:0070646 protein modification by small protein removal No
GO:0006508 proteolysis No
GO:0140096 catalytic activity, acting on a protein No
GO:0043170 macromolecule metabolic process No
GO:0019538 protein metabolic process No
GO:0043167 ion binding No
GO:0043412 macromolecule modification No
GO:0036211 protein modification process No
GO:0008233 peptidase activity No
GO:0003674 molecular_function No
GO:1901564 organonitrogen compound metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043169 cation binding No
GO:0016787 hydrolase activity No
GO:0019783 ubiquitin-like protein peptidase activity No
GO:0071704 organic substance metabolic process No
GO:0101005 deubiquitinase activity No
GO:0008234 cysteine-type peptidase activity No
GO:0006807 nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 16 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6614
MSTASNTPASPRNVKVKSPSPGNPMFGCEHVQLLLSQGQEVMNSSIAHYKMILRGIFDATPIVPQTSTNHEGRPI
TCLTSNYLCLQCPTTVSEEDRLKHGSKRSHRFYVDSRNGSLYCQICDDLVLDPTLEELRVRKIGTGSFTGRKRKH
DELFADSVKDDPRYISANTMTASCRANGLRGIYNAGATCYQNVVLQSFLHNPLLRNFYLSDGHQNTDCQIQHCLS
CAMDDMFQDFYALENTNGYTAANILSGFWISEKKAFENLVTTKEQDAHEFFQFLAEELHERNGDGKRPEIGSEHS
CNCIIHQTFYGKMLTTTTCQNCKGTTHAVQSFLDLSLGLDNLAQKRVKKTSQSMPILSLTDCLDEEYIKFDNIKR
LPNVLSIQLKVRFEYKQGRHDRAASKMDNAVQFPLQLNMLPYTNSVRSRESRDNLELERSCIYDLLSEDPTFDGG
ALLSDADKIYDSLQWFKFNDHKVELASVSDVLGAQAYLLFYIIRSLA*
Coding >Ophun1|6614
ATGTCCACGGCGTCTAACACACCAGCTTCCCCCAGGAACGTCAAGGTCAAGTCGCCGTCCCCAGGAAACCCCATG
TTTGGCTGCGAACATGTTCAGCTATTGCTTTCGCAAGGTCAAGAAGTTATGAACAGCTCAATTGCACATTATAAG
ATGATACTGCGGGGCATTTTTGATGCTACTCCTATCGTACCCCAAACATCCACAAATCATGAGGGACGCCCTATC
ACCTGCTTGACGTCGAATTACCTCTGTCTTCAGTGCCCGACTACAGTGTCAGAGGAAGATCGCCTGAAGCATGGC
TCCAAGAGATCGCATCGCTTCTATGTGGACTCTCGCAACGGTTCCCTATACTGCCAAATCTGCGACGATCTGGTC
CTGGATCCTACTCTGGAGGAGCTTCGCGTGCGCAAGATTGGCACGGGATCTTTCACAGGTCGGAAAAGGAAACAC
GACGAGCTCTTCGCCGACTCAGTAAAGGATGACCCTCGGTATATCAGCGCCAACACTATGACTGCTTCCTGCCGG
GCGAATGGTCTTCGAGGCATATACAATGCTGGAGCAACGTGTTACCAAAACGTCGTGTTGCAAAGCTTTCTACAC
AATCCCCTCCTCCGCAACTTTTACTTAAGCGACGGGCACCAAAACACTGATTGCCAGATTCAACATTGTCTCAGT
TGTGCAATGGACGACATGTTTCAAGATTTCTATGCTTTAGAGAATACAAATGGTTATACGGCAGCCAATATCCTC
TCTGGTTTTTGGATATCCGAGAAAAAGGCTTTCGAGAACCTTGTCACAACCAAGGAACAAGACGCGCATGAATTT
TTTCAGTTTTTGGCTGAGGAACTCCACGAGCGCAATGGAGACGGAAAGAGACCGGAAATCGGAAGCGAACATAGC
TGCAATTGCATTATCCATCAGACATTTTATGGGAAGATGCTGACAACTACGACGTGTCAAAACTGCAAGGGAACT
ACTCATGCTGTCCAGTCTTTTCTTGATCTTAGCCTGGGACTGGATAACTTGGCACAGAAGCGAGTCAAGAAGACC
AGCCAAAGTATGCCAATCTTGTCGTTAACCGACTGCCTGGACGAGGAATACATCAAATTCGACAACATTAAACGC
TTGCCCAACGTGCTGTCCATTCAGCTCAAGGTTAGGTTTGAGTACAAGCAGGGAAGACACGACCGAGCGGCGTCA
AAGATGGACAACGCTGTGCAATTTCCTCTCCAGCTCAACATGCTGCCCTACACAAACTCTGTTCGCAGTCGCGAG
AGCCGCGATAACCTGGAGCTCGAAAGATCTTGCATCTACGACCTTTTAAGTGAGGACCCAACGTTTGACGGAGGA
GCTTTACTGAGTGATGCTGATAAAATCTACGACTCGTTGCAGTGGTTTAAATTCAATGACCATAAAGTAGAACTG
GCAAGTGTATCCGATGTCCTCGGTGCCCAGGCCTATCTTCTGTTTTACATTATCAGGTCACTCGCCTAG
Transcript >Ophun1|6614
ATGTCCACGGCGTCTAACACACCAGCTTCCCCCAGGAACGTCAAGGTCAAGTCGCCGTCCCCAGGAAACCCCATG
TTTGGCTGCGAACATGTTCAGCTATTGCTTTCGCAAGGTCAAGAAGTTATGAACAGCTCAATTGCACATTATAAG
ATGATACTGCGGGGCATTTTTGATGCTACTCCTATCGTACCCCAAACATCCACAAATCATGAGGGACGCCCTATC
ACCTGCTTGACGTCGAATTACCTCTGTCTTCAGTGCCCGACTACAGTGTCAGAGGAAGATCGCCTGAAGCATGGC
TCCAAGAGATCGCATCGCTTCTATGTGGACTCTCGCAACGGTTCCCTATACTGCCAAATCTGCGACGATCTGGTC
CTGGATCCTACTCTGGAGGAGCTTCGCGTGCGCAAGATTGGCACGGGATCTTTCACAGGTCGGAAAAGGAAACAC
GACGAGCTCTTCGCCGACTCAGTAAAGGATGACCCTCGGTATATCAGCGCCAACACTATGACTGCTTCCTGCCGG
GCGAATGGTCTTCGAGGCATATACAATGCTGGAGCAACGTGTTACCAAAACGTCGTGTTGCAAAGCTTTCTACAC
AATCCCCTCCTCCGCAACTTTTACTTAAGCGACGGGCACCAAAACACTGATTGCCAGATTCAACATTGTCTCAGT
TGTGCAATGGACGACATGTTTCAAGATTTCTATGCTTTAGAGAATACAAATGGTTATACGGCAGCCAATATCCTC
TCTGGTTTTTGGATATCCGAGAAAAAGGCTTTCGAGAACCTTGTCACAACCAAGGAACAAGACGCGCATGAATTT
TTTCAGTTTTTGGCTGAGGAACTCCACGAGCGCAATGGAGACGGAAAGAGACCGGAAATCGGAAGCGAACATAGC
TGCAATTGCATTATCCATCAGACATTTTATGGGAAGATGCTGACAACTACGACGTGTCAAAACTGCAAGGGAACT
ACTCATGCTGTCCAGTCTTTTCTTGATCTTAGCCTGGGACTGGATAACTTGGCACAGAAGCGAGTCAAGAAGACC
AGCCAAAGTATGCCAATCTTGTCGTTAACCGACTGCCTGGACGAGGAATACATCAAATTCGACAACATTAAACGC
TTGCCCAACGTGCTGTCCATTCAGCTCAAGGTTAGGTTTGAGTACAAGCAGGGAAGACACGACCGAGCGGCGTCA
AAGATGGACAACGCTGTGCAATTTCCTCTCCAGCTCAACATGCTGCCCTACACAAACTCTGTTCGCAGTCGCGAG
AGCCGCGATAACCTGGAGCTCGAAAGATCTTGCATCTACGACCTTTTAAGTGAGGACCCAACGTTTGACGGAGGA
GCTTTACTGAGTGATGCTGATAAAATCTACGACTCGTTGCAGTGGTTTAAATTCAATGACCATAAAGTAGAACTG
GCAAGTGTATCCGATGTCCTCGGTGCCCAGGCCTATCTTCTGTTTTACATTATCAGGTCACTCGCCTAG
Gene >Ophun1|6614
ATGTCCACGGCGTCTAACACACCAGCTTCCCCCAGGAACGTCAAGGTCAAGTCGCCGTCCCCAGGAAACCCCATG
TTTGGCTGCGGTATGTATTACGAAGCTGCTACGAACGCCTGGGTGCGGCCACACCGATATCTGAACCGAAAGTTG
TTCCCTAGAACATGTTCAGCTATTGCTTTCGCAAGGTCAAGAAGTTATGAACAGCTCAATTGCACATTATAAGAT
GATACTGCGGGGCATTTTTGATGCTACTCCTATCGTACCCCAAACATCCACAAATCATGAGGGACGCCCTATCAC
CTGCTTGACGTCGAATTACCTCTGTCTTCAGTGCCCGACTACAGTGTCAGAGGAAGATCGCCTGAAGCATGGCTC
CAAGAGATCGCATCGCTTCTGTATGCATCGGAAGACCCGTAAATACCTCGGATTCATAACGGTACTGACCCTTTG
GTAGATGTGGACTCTCGCAACGGTTCCCTATACTGCCAAATCTGCGACGATCTGGTCCTGGATCCTACTCTGGAG
GAGCTTCGCGTGCGCAAGATTGGCACGGGATCTTTCACAGGTATACGGCTAGATTTTACATCGCTTTGTCTATCG
AAGTTGTCTAATTGTCGTCTGTCAGGTCGGAAAAGGAAACACGACGAGCTCTTCGCCGACTCAGTAAAGGATGAC
CCTCGGTATATCAGCGCCAACACTATGACTGCTTCCTGCCGGGCGAATGGTCTTCGAGGCATATACAATGCTGGA
GCAACGTGTTACCAAAACGTCGTGTTGCAAAGCTTTCTACACAATCCCCTCCTCCGCAACTTTTACTTAAGCGAC
GGGCACCAAAACACTGATTGCCAGATTCAACATTGTCTCAGTTGTGCAATGGACGACATGTTTCAAGATTTCTAT
GCTTTAGAGAATACAAATGGTTATACGGCAGCCAATATCCTCTCTGGTTTTTGGATATCCGAGAAAAAGGCTTTC
GAGAACCTTGTCACAACCAAGGAACAAGACGCGCATGAATTTTTTCAGTTTTTGGCTGAGGAACTCCACGAGCGC
AATGGAGACGGAAAGAGACCGGAAATCGGAAGCGAACATAGCTGCAATTGCATTATCCATCAGACATTTTATGGG
AAGATGCTGACAACTACGACGTGTCAAAACTGCAAGGGAACTACTCATGCTGTCCAGTCTTTTCTTGATCTTAGC
CTGGGACTGGATAACTTGGCACAGAAGCGAGTCAAGAAGACCAGCCAAAGTATGCCAATCTTGTCGTTAACCGAC
TGCCTGGACGAGGAATACATCAAATTCGACAAGTGCGAGTATCGATGCCACAATTGTATATCTTTACAACAGGCT
AAGAGATACACAAGCATTAAACGCTTGCCCAACGTGCTGTCCATTCAGCTCAAGGTTGTAACGGCATGCTTCGCG
TTGTAAGCTCCAGAACGCATGTGCTAACAGTATTCTCTTAGAGGTTTGAGTACAAGCAGGGAAGACACGACCGAG
CGGCGTCAAAGATGGACAACGCTGTGCAATTTCCTCTCCAGCTCAACATGCTGCCCTACACAAACTCTGTTCGCA
GTCGCGAGAGCCGCGATAACCTGGAGCTCGAAAGATCTTGCATCTACGACCTTTTAAGTGTCGTTGTTCACGTTG
GGGAAATTGAGACCGGCCACTACGTCTCTTATTGTCGTGTTGGCGACCAGGTGAGGACCCAACGTTTGACGGAGG
AGCTTTACTGAGTGATGCTGATAAAATCTACGACTCGTTGCAGTGGTTTAAATTCAATGACCATAAAGTAGAACT
GGCAAGTGTATCCGATGTCCTCGGTGCCCAGGCCTATCTTCTGTTTTACATTATCAGGTCACTCGCCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail