Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|661
Gene name
LocationContig_1204:95..438
Strand-
Gene length (bp)343
Transcript length (bp)276
Coding sequence length (bp)276
Protein length (aa) 92

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07931 CPT Chloramphenicol phosphotransferase-like protein 1.3E-05 7 41

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0W1|NRK1_SCHPO Nicotinamide riboside kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrk1 PE=3 SV=1 1 81 4.0E-23
sp|P53915|NRK1_YEAST Nicotinamide riboside kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRK1 PE=1 SV=1 2 76 2.0E-14
sp|P62511|NRK1_ASHGO Nicotinamide riboside kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NRK1 PE=3 SV=1 2 75 9.0E-13
sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens GN=NMRK1 PE=1 SV=1 4 72 3.0E-11
sp|Q9NPI5|NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens GN=NMRK2 PE=1 SV=1 6 71 4.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C0W1|NRK1_SCHPO Nicotinamide riboside kinase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrk1 PE=3 SV=1 1 81 4.0E-23
sp|P53915|NRK1_YEAST Nicotinamide riboside kinase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRK1 PE=1 SV=1 2 76 2.0E-14
sp|P62511|NRK1_ASHGO Nicotinamide riboside kinase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=NRK1 PE=3 SV=1 2 75 9.0E-13
sp|Q9NWW6|NRK1_HUMAN Nicotinamide riboside kinase 1 OS=Homo sapiens GN=NMRK1 PE=1 SV=1 4 72 3.0E-11
sp|Q9NPI5|NRK2_HUMAN Nicotinamide riboside kinase 2 OS=Homo sapiens GN=NMRK2 PE=1 SV=1 6 71 4.0E-10
sp|Q6AY91|NRK1_RAT Nicotinamide riboside kinase 1 OS=Rattus norvegicus GN=Nmrk1 PE=2 SV=1 4 72 1.0E-09
sp|Q9D7C9|NRK2_MOUSE Nicotinamide riboside kinase 2 OS=Mus musculus GN=Nmrk2 PE=1 SV=1 6 71 1.0E-09
sp|Q91W63|NRK1_MOUSE Nicotinamide riboside kinase 1 OS=Mus musculus GN=Nmrk1 PE=1 SV=1 6 72 2.0E-09
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup16871
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|661 (this protein)

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|661
MSPSALIVALSGCSSSGKTTLARLIRDLFPGTFILHQDDFYRPEAELPFKNGLRDWDCAEAVDVPAMIEALTYIR
HHASFPVCPLFPTKPP*
Coding >Ophun1|661
ATGTCCCCATCAGCTCTGATAGTCGCTCTTTCTGGCTGTTCCTCCAGCGGAAAGACGACGCTCGCCCGCCTTATC
CGCGATCTCTTCCCCGGCACCTTTATCCTCCACCAAGATGACTTTTACAGGCCCGAAGCTGAACTACCCTTCAAG
AATGGTCTGCGAGACTGGGATTGCGCAGAAGCCGTCGACGTCCCTGCCATGATCGAAGCCCTGACTTACATCCGC
CACCACGCCTCATTTCCCGTATGTCCCCTCTTCCCAACAAAGCCCCCATGA
Transcript >Ophun1|661
ATGTCCCCATCAGCTCTGATAGTCGCTCTTTCTGGCTGTTCCTCCAGCGGAAAGACGACGCTCGCCCGCCTTATC
CGCGATCTCTTCCCCGGCACCTTTATCCTCCACCAAGATGACTTTTACAGGCCCGAAGCTGAACTACCCTTCAAG
AATGGTCTGCGAGACTGGGATTGCGCAGAAGCCGTCGACGTCCCTGCCATGATCGAAGCCCTGACTTACATCCGC
CACCACGCCTCATTTCCCGTATGTCCCCTCTTCCCAACAAAGCCCCCATGA
Gene >Ophun1|661
ATGTCCCCATCAGCTCTGATAGTCGCTCTTTCTGGCTGTTCCTCCAGCGGAAAGACGACGCTCGCCCGCCTTATC
CGCGATCTCTTCCCCGGCACCTTTATCCTCCACCAAGATGACTTTTACAGGCCCGAAGCTGAGTGCGCCAACCTT
GACTCTTGCCCTTGTATACGTCCATCATCTCATGTTCTTGTCGTTATGATCTAGACTACCCTTCAAGAATGGTCT
GCGAGACTGGGATTGCGCAGAAGCCGTCGACGTCCCTGCCATGATCGAAGCCCTGACTTACATCCGCCACCACGC
CTCATTTCCCGTATGTCCCCTCTTCCCAACAAAGCCCCCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail