Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6602
Gene name
LocationContig_732:2041..4516
Strand-
Gene length (bp)2475
Transcript length (bp)2475
Coding sequence length (bp)2475
Protein length (aa) 825

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02187 GAS2 Growth-Arrest-Specific Protein 2 Domain 6.2E-07 595 642

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008017 microtubule binding Yes
GO:0008092 cytoskeletal protein binding No
GO:0003674 molecular_function No
GO:0005515 protein binding No
GO:0015631 tubulin binding No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1582
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6000
Ophiocordyceps australis map64 (Brazil) OphauB2|3620
Ophiocordyceps camponoti-floridani Ophcf2|05071
Ophiocordyceps camponoti-rufipedis Ophun1|6602 (this protein)
Ophiocordyceps kimflemingae Ophio5|3633
Ophiocordyceps subramaniannii Hirsu2|1195

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6602
MAEHARLRHLHPRRLSSFLPVIRDDLLARLGPATVLEALAAPAGALSACLDTAPPSDRDLAVRAAVISRRVWEWL
TELDGWTWSGFAAGPSDVDDACYAARIDEVGREMGRLDVEDIKKNVLQNHLRPLSRPTTPATDSDGLSLLSLSSA
ASSYYRMDDLTAVITTIVMQALPNLARLSALLRLWTLRLRVLQNVPLFLSALDDAETGLASAWAQSDGRGLQATA
RALAADVAEPARLLDYMLDCLEGLPDTLPDVWIDRVEALERDHAEWLGVCERTLQDERLSTASAVKAEQYSAADD
SAIVASPGALDGTMAVNWPDEVWRGKAEDDSPPSTPPHDEVPRCYDGGDDDDVDDDVCTPPSPQSRLPTATGRGN
TTSGDALSTCDDSLLSGQVMSPIKEDGDDDDDVSGLPRLRTAISRQSLNSQASTLIFSGLGHSSSPPDMSTSPAA
RLRHTAAESPLQSPLRRSKTASATMGQTEDALFLKSPADESFAQDFDDTMSMMDGPSYTLRGEGGAGDDQLQQQI
SDIIDSIPARIKLASSPTLNPPDVRLRKPGSRDSGLLRRSASSLSSRAGTPSFTLSPAKHCRPRHRRAHQEIQVY
HLSRSTGEAPIKLFIRCVGEHGERVMVRVGGGWADLGEYLKAYASHHGRRSHGVEIRSGRLTPVAPVSDSSPTTR
PGSAADIHDMVSPATPIQMRKLRASELPSSSNSRPLPRTPSSLPSIITTITTKSTEPPSSDSAQSRSSSRISWVD
DDGDGASYLGLAGPSGRRVKMTDENRAWVESVKEKVRIASGSAGGLPSSSSRFGDLGAVGGTRRLFPAGTGRRR*
Coding >Ophun1|6602
ATGGCTGAACACGCGCGCCTCCGACATCTTCATCCCAGACGGCTCTCCTCCTTTTTGCCCGTCATTCGAGACGAC
CTCCTCGCCCGCCTCGGCCCCGCCACCGTCCTCGAGGCACTGGCTGCTCCGGCCGGCGCTCTAAGCGCCTGTCTC
GACACCGCTCCCCCGTCCGATCGGGATCTCGCCGTCCGCGCCGCGGTCATTTCGCGCCGAGTATGGGAGTGGCTG
ACAGAGTTGGACGGTTGGACGTGGTCTGGCTTTGCTGCTGGCCCGTCCGACGTTGACGACGCCTGCTACGCTGCC
CGGATTGATGAAGTCGGCCGCGAGATGGGTCGGCTCGACGTCGAGGATATCAAGAAGAATGTGCTGCAGAACCAT
CTGCGGCCGCTGTCGAGACCGACGACGCCGGCTACCGACTCGGACGGTCTGTCTTTGCTGTCGCTGTCGTCGGCG
GCTTCGAGTTACTATAGAATGGACGACCTGACAGCCGTCATCACCACCATCGTCATGCAGGCCCTTCCCAACCTG
GCTCGTCTATCGGCCTTGCTGCGCCTCTGGACACTCCGTCTGCGGGTGCTTCAGAACGTGCCTCTCTTCTTGTCT
GCTCTCGACGACGCTGAGACCGGCCTTGCGTCCGCCTGGGCCCAGAGTGACGGCCGAGGCCTGCAGGCTACCGCC
CGAGCTCTCGCCGCCGATGTCGCCGAGCCCGCTCGTCTACTCGACTATATGCTGGATTGTCTCGAGGGCTTACCG
GACACGCTTCCCGATGTCTGGATCGATCGTGTCGAGGCCCTCGAGCGAGATCACGCCGAGTGGCTCGGAGTCTGC
GAGCGCACTCTACAAGACGAGCGGCTATCGACGGCATCGGCGGTCAAGGCGGAGCAGTATTCCGCTGCCGACGAT
AGCGCTATAGTCGCCTCGCCTGGAGCGCTCGATGGGACCATGGCTGTTAACTGGCCGGATGAGGTCTGGAGAGGC
AAGGCGGAGGACGATTCGCCTCCTTCGACACCTCCTCACGACGAGGTACCGAGATGTTACGATGGTGGGGACGAC
GACGACGTTGATGATGACGTCTGTACTCCTCCCTCTCCACAGAGCCGACTGCCGACGGCGACGGGCCGAGGCAAC
ACGACGTCTGGCGACGCCCTATCGACATGCGACGATTCTCTCCTCTCTGGCCAGGTCATGTCGCCCATCAAGGAA
GACGGCGACGACGATGACGACGTTTCCGGACTGCCGAGGCTTCGAACGGCCATCAGCCGGCAAAGCCTCAACTCG
CAGGCCTCGACGCTCATCTTCAGCGGCCTCGGCCATTCCAGCTCGCCCCCGGACATGTCAACGTCGCCCGCAGCC
CGACTGCGTCATACGGCAGCCGAGAGCCCGCTCCAGTCACCGCTGAGACGGTCCAAGACGGCATCAGCGACGATG
GGACAGACGGAGGACGCCCTCTTCCTCAAGTCGCCGGCGGACGAGTCGTTCGCCCAAGACTTTGACGACACCATG
TCCATGATGGACGGCCCCAGCTACACTCTCAGGGGCGAGGGCGGCGCTGGCGATGATCAGCTTCAGCAGCAGATC
AGCGACATCATCGACTCGATCCCAGCCCGTATCAAGCTCGCCTCTTCACCCACCCTCAACCCACCCGACGTGCGT
CTCCGGAAACCCGGCTCGCGCGATTCAGGCCTCCTTCGCAGAAGCGCATCCAGCCTATCATCGCGGGCTGGGACG
CCTTCCTTCACCCTCTCGCCGGCCAAGCATTGCCGGCCTCGACATCGACGCGCTCACCAGGAGATTCAGGTGTAT
CACCTGTCGCGGTCGACGGGCGAGGCGCCCATCAAGCTCTTCATCCGCTGCGTTGGCGAGCATGGCGAGCGTGTC
ATGGTGCGCGTTGGAGGCGGATGGGCTGATCTGGGCGAGTATCTTAAGGCGTATGCCAGCCATCACGGTCGTCGC
TCGCATGGCGTCGAGATTCGATCCGGGAGACTTACACCCGTTGCTCCCGTCTCGGATTCGAGCCCGACGACGCGG
CCCGGTTCCGCTGCCGATATTCACGACATGGTCTCTCCCGCGACCCCTATTCAGATGCGCAAGCTCCGAGCATCA
GAGCTCCCCTCATCATCTAACTCCCGCCCCCTTCCAAGAACCCCCTCCAGCCTCCCCTCCATCATCACAACAATC
ACCACGAAATCCACGGAGCCCCCTTCTTCCGACTCAGCCCAGTCCCGCTCCAGCTCACGCATAAGCTGGGTCGAC
GACGACGGCGACGGCGCCTCGTACCTCGGACTTGCAGGGCCCTCGGGTCGCAGGGTGAAGATGACGGACGAGAAT
AGGGCTTGGGTGGAGAGCGTCAAGGAAAAGGTTCGGATTGCTAGTGGTTCGGCGGGGGGTTTACCTTCTTCCTCG
TCTCGGTTTGGGGACTTGGGGGCTGTTGGAGGGACGAGGAGGCTGTTTCCCGCTGGGACTGGGAGGAGGCGGTGA
Transcript >Ophun1|6602
ATGGCTGAACACGCGCGCCTCCGACATCTTCATCCCAGACGGCTCTCCTCCTTTTTGCCCGTCATTCGAGACGAC
CTCCTCGCCCGCCTCGGCCCCGCCACCGTCCTCGAGGCACTGGCTGCTCCGGCCGGCGCTCTAAGCGCCTGTCTC
GACACCGCTCCCCCGTCCGATCGGGATCTCGCCGTCCGCGCCGCGGTCATTTCGCGCCGAGTATGGGAGTGGCTG
ACAGAGTTGGACGGTTGGACGTGGTCTGGCTTTGCTGCTGGCCCGTCCGACGTTGACGACGCCTGCTACGCTGCC
CGGATTGATGAAGTCGGCCGCGAGATGGGTCGGCTCGACGTCGAGGATATCAAGAAGAATGTGCTGCAGAACCAT
CTGCGGCCGCTGTCGAGACCGACGACGCCGGCTACCGACTCGGACGGTCTGTCTTTGCTGTCGCTGTCGTCGGCG
GCTTCGAGTTACTATAGAATGGACGACCTGACAGCCGTCATCACCACCATCGTCATGCAGGCCCTTCCCAACCTG
GCTCGTCTATCGGCCTTGCTGCGCCTCTGGACACTCCGTCTGCGGGTGCTTCAGAACGTGCCTCTCTTCTTGTCT
GCTCTCGACGACGCTGAGACCGGCCTTGCGTCCGCCTGGGCCCAGAGTGACGGCCGAGGCCTGCAGGCTACCGCC
CGAGCTCTCGCCGCCGATGTCGCCGAGCCCGCTCGTCTACTCGACTATATGCTGGATTGTCTCGAGGGCTTACCG
GACACGCTTCCCGATGTCTGGATCGATCGTGTCGAGGCCCTCGAGCGAGATCACGCCGAGTGGCTCGGAGTCTGC
GAGCGCACTCTACAAGACGAGCGGCTATCGACGGCATCGGCGGTCAAGGCGGAGCAGTATTCCGCTGCCGACGAT
AGCGCTATAGTCGCCTCGCCTGGAGCGCTCGATGGGACCATGGCTGTTAACTGGCCGGATGAGGTCTGGAGAGGC
AAGGCGGAGGACGATTCGCCTCCTTCGACACCTCCTCACGACGAGGTACCGAGATGTTACGATGGTGGGGACGAC
GACGACGTTGATGATGACGTCTGTACTCCTCCCTCTCCACAGAGCCGACTGCCGACGGCGACGGGCCGAGGCAAC
ACGACGTCTGGCGACGCCCTATCGACATGCGACGATTCTCTCCTCTCTGGCCAGGTCATGTCGCCCATCAAGGAA
GACGGCGACGACGATGACGACGTTTCCGGACTGCCGAGGCTTCGAACGGCCATCAGCCGGCAAAGCCTCAACTCG
CAGGCCTCGACGCTCATCTTCAGCGGCCTCGGCCATTCCAGCTCGCCCCCGGACATGTCAACGTCGCCCGCAGCC
CGACTGCGTCATACGGCAGCCGAGAGCCCGCTCCAGTCACCGCTGAGACGGTCCAAGACGGCATCAGCGACGATG
GGACAGACGGAGGACGCCCTCTTCCTCAAGTCGCCGGCGGACGAGTCGTTCGCCCAAGACTTTGACGACACCATG
TCCATGATGGACGGCCCCAGCTACACTCTCAGGGGCGAGGGCGGCGCTGGCGATGATCAGCTTCAGCAGCAGATC
AGCGACATCATCGACTCGATCCCAGCCCGTATCAAGCTCGCCTCTTCACCCACCCTCAACCCACCCGACGTGCGT
CTCCGGAAACCCGGCTCGCGCGATTCAGGCCTCCTTCGCAGAAGCGCATCCAGCCTATCATCGCGGGCTGGGACG
CCTTCCTTCACCCTCTCGCCGGCCAAGCATTGCCGGCCTCGACATCGACGCGCTCACCAGGAGATTCAGGTGTAT
CACCTGTCGCGGTCGACGGGCGAGGCGCCCATCAAGCTCTTCATCCGCTGCGTTGGCGAGCATGGCGAGCGTGTC
ATGGTGCGCGTTGGAGGCGGATGGGCTGATCTGGGCGAGTATCTTAAGGCGTATGCCAGCCATCACGGTCGTCGC
TCGCATGGCGTCGAGATTCGATCCGGGAGACTTACACCCGTTGCTCCCGTCTCGGATTCGAGCCCGACGACGCGG
CCCGGTTCCGCTGCCGATATTCACGACATGGTCTCTCCCGCGACCCCTATTCAGATGCGCAAGCTCCGAGCATCA
GAGCTCCCCTCATCATCTAACTCCCGCCCCCTTCCAAGAACCCCCTCCAGCCTCCCCTCCATCATCACAACAATC
ACCACGAAATCCACGGAGCCCCCTTCTTCCGACTCAGCCCAGTCCCGCTCCAGCTCACGCATAAGCTGGGTCGAC
GACGACGGCGACGGCGCCTCGTACCTCGGACTTGCAGGGCCCTCGGGTCGCAGGGTGAAGATGACGGACGAGAAT
AGGGCTTGGGTGGAGAGCGTCAAGGAAAAGGTTCGGATTGCTAGTGGTTCGGCGGGGGGTTTACCTTCTTCCTCG
TCTCGGTTTGGGGACTTGGGGGCTGTTGGAGGGACGAGGAGGCTGTTTCCCGCTGGGACTGGGAGGAGGCGGTGA
Gene >Ophun1|6602
ATGGCTGAACACGCGCGCCTCCGACATCTTCATCCCAGACGGCTCTCCTCCTTTTTGCCCGTCATTCGAGACGAC
CTCCTCGCCCGCCTCGGCCCCGCCACCGTCCTCGAGGCACTGGCTGCTCCGGCCGGCGCTCTAAGCGCCTGTCTC
GACACCGCTCCCCCGTCCGATCGGGATCTCGCCGTCCGCGCCGCGGTCATTTCGCGCCGAGTATGGGAGTGGCTG
ACAGAGTTGGACGGTTGGACGTGGTCTGGCTTTGCTGCTGGCCCGTCCGACGTTGACGACGCCTGCTACGCTGCC
CGGATTGATGAAGTCGGCCGCGAGATGGGTCGGCTCGACGTCGAGGATATCAAGAAGAATGTGCTGCAGAACCAT
CTGCGGCCGCTGTCGAGACCGACGACGCCGGCTACCGACTCGGACGGTCTGTCTTTGCTGTCGCTGTCGTCGGCG
GCTTCGAGTTACTATAGAATGGACGACCTGACAGCCGTCATCACCACCATCGTCATGCAGGCCCTTCCCAACCTG
GCTCGTCTATCGGCCTTGCTGCGCCTCTGGACACTCCGTCTGCGGGTGCTTCAGAACGTGCCTCTCTTCTTGTCT
GCTCTCGACGACGCTGAGACCGGCCTTGCGTCCGCCTGGGCCCAGAGTGACGGCCGAGGCCTGCAGGCTACCGCC
CGAGCTCTCGCCGCCGATGTCGCCGAGCCCGCTCGTCTACTCGACTATATGCTGGATTGTCTCGAGGGCTTACCG
GACACGCTTCCCGATGTCTGGATCGATCGTGTCGAGGCCCTCGAGCGAGATCACGCCGAGTGGCTCGGAGTCTGC
GAGCGCACTCTACAAGACGAGCGGCTATCGACGGCATCGGCGGTCAAGGCGGAGCAGTATTCCGCTGCCGACGAT
AGCGCTATAGTCGCCTCGCCTGGAGCGCTCGATGGGACCATGGCTGTTAACTGGCCGGATGAGGTCTGGAGAGGC
AAGGCGGAGGACGATTCGCCTCCTTCGACACCTCCTCACGACGAGGTACCGAGATGTTACGATGGTGGGGACGAC
GACGACGTTGATGATGACGTCTGTACTCCTCCCTCTCCACAGAGCCGACTGCCGACGGCGACGGGCCGAGGCAAC
ACGACGTCTGGCGACGCCCTATCGACATGCGACGATTCTCTCCTCTCTGGCCAGGTCATGTCGCCCATCAAGGAA
GACGGCGACGACGATGACGACGTTTCCGGACTGCCGAGGCTTCGAACGGCCATCAGCCGGCAAAGCCTCAACTCG
CAGGCCTCGACGCTCATCTTCAGCGGCCTCGGCCATTCCAGCTCGCCCCCGGACATGTCAACGTCGCCCGCAGCC
CGACTGCGTCATACGGCAGCCGAGAGCCCGCTCCAGTCACCGCTGAGACGGTCCAAGACGGCATCAGCGACGATG
GGACAGACGGAGGACGCCCTCTTCCTCAAGTCGCCGGCGGACGAGTCGTTCGCCCAAGACTTTGACGACACCATG
TCCATGATGGACGGCCCCAGCTACACTCTCAGGGGCGAGGGCGGCGCTGGCGATGATCAGCTTCAGCAGCAGATC
AGCGACATCATCGACTCGATCCCAGCCCGTATCAAGCTCGCCTCTTCACCCACCCTCAACCCACCCGACGTGCGT
CTCCGGAAACCCGGCTCGCGCGATTCAGGCCTCCTTCGCAGAAGCGCATCCAGCCTATCATCGCGGGCTGGGACG
CCTTCCTTCACCCTCTCGCCGGCCAAGCATTGCCGGCCTCGACATCGACGCGCTCACCAGGAGATTCAGGTGTAT
CACCTGTCGCGGTCGACGGGCGAGGCGCCCATCAAGCTCTTCATCCGCTGCGTTGGCGAGCATGGCGAGCGTGTC
ATGGTGCGCGTTGGAGGCGGATGGGCTGATCTGGGCGAGTATCTTAAGGCGTATGCCAGCCATCACGGTCGTCGC
TCGCATGGCGTCGAGATTCGATCCGGGAGACTTACACCCGTTGCTCCCGTCTCGGATTCGAGCCCGACGACGCGG
CCCGGTTCCGCTGCCGATATTCACGACATGGTCTCTCCCGCGACCCCTATTCAGATGCGCAAGCTCCGAGCATCA
GAGCTCCCCTCATCATCTAACTCCCGCCCCCTTCCAAGAACCCCCTCCAGCCTCCCCTCCATCATCACAACAATC
ACCACGAAATCCACGGAGCCCCCTTCTTCCGACTCAGCCCAGTCCCGCTCCAGCTCACGCATAAGCTGGGTCGAC
GACGACGGCGACGGCGCCTCGTACCTCGGACTTGCAGGGCCCTCGGGTCGCAGGGTGAAGATGACGGACGAGAAT
AGGGCTTGGGTGGAGAGCGTCAAGGAAAAGGTTCGGATTGCTAGTGGTTCGGCGGGGGGTTTACCTTCTTCCTCG
TCTCGGTTTGGGGACTTGGGGGCTGTTGGAGGGACGAGGAGGCTGTTTCCCGCTGGGACTGGGAGGAGGCGGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail