Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6594
Gene name
LocationContig_73:38826..42570
Strand+
Gene length (bp)3744
Transcript length (bp)3633
Coding sequence length (bp)3633
Protein length (aa) 1211

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02463 SMC_N RecF/RecN/SMC N terminal domain 2.4E-41 1 1195
PF06470 SMC_hinge SMC proteins Flexible Hinge Domain 3.3E-25 498 613

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q1P4|SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana GN=SMC1 PE=2 SV=2 1 1209 0.0E+00
sp|O94383|SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm1 PE=1 SV=2 1 1210 0.0E+00
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 1 1209 0.0E+00
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 1 1209 0.0E+00
sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 1 1209 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6Q1P4|SMC1_ARATH Structural maintenance of chromosomes protein 1 OS=Arabidopsis thaliana GN=SMC1 PE=2 SV=2 1 1209 0.0E+00
sp|O94383|SMC1_SCHPO Structural maintenance of chromosomes protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psm1 PE=1 SV=2 1 1210 0.0E+00
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protein 1A OS=Rattus norvegicus GN=Smc1a PE=1 SV=1 1 1209 0.0E+00
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes protein 1A OS=Mus musculus GN=Smc1a PE=1 SV=4 1 1209 0.0E+00
sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes protein 1A OS=Homo sapiens GN=SMC1A PE=1 SV=2 1 1209 0.0E+00
sp|P32908|SMC1_YEAST Structural maintenance of chromosomes protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC1 PE=1 SV=1 1 1210 0.0E+00
sp|O97593|SMC1A_BOVIN Structural maintenance of chromosomes protein 1A OS=Bos taurus GN=SMC1A PE=1 SV=1 1 1209 0.0E+00
sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes protein 1A OS=Xenopus laevis GN=smc1a PE=1 SV=1 1 1209 9.0E-178
sp|Q8NDV3|SMC1B_HUMAN Structural maintenance of chromosomes protein 1B OS=Homo sapiens GN=SMC1B PE=2 SV=2 1 1209 3.0E-156
sp|Q920F6|SMC1B_MOUSE Structural maintenance of chromosomes protein 1B OS=Mus musculus GN=Smc1b PE=1 SV=1 1 1209 5.0E-150
sp|O01789|SMC1_CAEEL Structural maintenance of chromosomes protein 1 OS=Caenorhabditis elegans GN=him-1 PE=1 SV=4 1 1209 8.0E-146
sp|P50532|SMC4_XENLA Structural maintenance of chromosomes protein 4 OS=Xenopus laevis GN=smc4 PE=1 SV=1 83 1199 1.0E-60
sp|Q9NTJ3|SMC4_HUMAN Structural maintenance of chromosomes protein 4 OS=Homo sapiens GN=SMC4 PE=1 SV=2 1 1199 2.0E-54
sp|Q8CG47|SMC4_MOUSE Structural maintenance of chromosomes protein 4 OS=Mus musculus GN=Smc4 PE=1 SV=1 1 1210 4.0E-54
sp|B8CW13|SMC_HALOH Chromosome partition protein Smc OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=smc PE=3 SV=1 1 1206 1.0E-50
sp|Q54LV0|SMC4_DICDI Structural maintenance of chromosomes protein 4 OS=Dictyostelium discoideum GN=smc4 PE=3 SV=1 499 1210 1.0E-44
sp|P41004|SMC4_SCHPO Structural maintenance of chromosomes protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut3 PE=1 SV=2 1 1202 7.0E-44
sp|O66878|SMC_AQUAE Chromosome partition protein Smc OS=Aquifex aeolicus (strain VF5) GN=smc PE=3 SV=1 460 1190 1.0E-42
sp|Q69GZ5|SMC_METVO Chromosome partition protein Smc OS=Methanococcus voltae GN=smc PE=3 SV=1 122 1190 5.0E-41
sp|P51834|SMC_BACSU Chromosome partition protein Smc OS=Bacillus subtilis (strain 168) GN=smc PE=1 SV=3 2 1206 3.0E-38
sp|Q20060|SMC4_CAEEL Structural maintenance of chromosomes protein 4 OS=Caenorhabditis elegans GN=smc-4 PE=1 SV=1 502 1192 2.0E-37
sp|O95347|SMC2_HUMAN Structural maintenance of chromosomes protein 2 OS=Homo sapiens GN=SMC2 PE=1 SV=2 1 1187 1.0E-35
sp|Q12267|SMC4_YEAST Structural maintenance of chromosomes protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC4 PE=1 SV=1 974 1206 1.0E-32
sp|Q9FJL0|SMC4_ARATH Structural maintenance of chromosomes protein 4 OS=Arabidopsis thaliana GN=SMC4 PE=1 SV=1 990 1210 2.0E-31
sp|Q8TZY2|SMC_PYRFU Chromosome partition protein Smc OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=smc PE=1 SV=2 1003 1205 6.0E-27
sp|Q8CG48|SMC2_MOUSE Structural maintenance of chromosomes protein 2 OS=Mus musculus GN=Smc2 PE=1 SV=2 500 1187 9.0E-27
sp|Q90988|SMC2_CHICK Structural maintenance of chromosomes protein 2 OS=Gallus gallus GN=SMC2 PE=2 SV=1 461 1203 2.0E-25
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 1035 1192 8.0E-25
sp|Q88WJ9|SMC_LACPL Chromosome partition protein Smc OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=smc PE=3 SV=1 1006 1190 2.0E-22
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 1 648 9.0E-22
sp|Q81ZL2|SMC_COXBU Chromosome partition protein Smc OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=smc PE=3 SV=1 972 1207 1.0E-21
sp|Q5H054|SMC_XANOR Chromosome partition protein Smc OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=smc PE=3 SV=2 970 1206 2.0E-21
sp|P73340|SMC_SYNY3 Chromosome partition protein Smc OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=smc PE=3 SV=1 966 1190 3.0E-21
sp|Q7UQV4|SMC_RHOBA Chromosome partition protein Smc OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=smc PE=3 SV=2 458 1190 9.0E-21
sp|Q604U6|SMC_METCA Chromosome partition protein Smc OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=smc PE=3 SV=2 986 1206 9.0E-21
sp|Q7NG51|SMC_GLOVI Chromosome partition protein Smc OS=Gloeobacter violaceus (strain PCC 7421) GN=smc PE=3 SV=1 1000 1190 1.0E-20
sp|Q5N0D2|SMC_SYNP6 Chromosome partition protein Smc OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=smc PE=3 SV=2 991 1190 2.0E-20
sp|P9WGF2|SMC_MYCTO Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=smc PE=3 SV=1 998 1190 4.0E-20
sp|Q3JR19|SMC_BURP1 Chromosome partition protein Smc OS=Burkholderia pseudomallei (strain 1710b) GN=smc PE=3 SV=2 974 1206 4.0E-20
sp|P9WGF3|SMC_MYCTU Chromosome partition protein Smc OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=smc PE=1 SV=1 998 1190 4.0E-20
sp|A9BZW2|SMC_DELAS Chromosome partition protein Smc OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=smc PE=3 SV=2 988 1206 8.0E-20
sp|Q7ZAK1|SMC_THEEB Chromosome partition protein Smc OS=Thermosynechococcus elongatus (strain BP-1) GN=smc PE=3 SV=1 989 1209 1.0E-19
sp|Q9ERA5|SMC4_MICAR Structural maintenance of chromosomes protein 4 (Fragment) OS=Microtus arvalis GN=SMC4 PE=2 SV=1 1 706 1.0E-19
sp|B9E1H0|SMC_CLOK1 Chromosome partition protein Smc OS=Clostridium kluyveri (strain NBRC 12016) GN=smc PE=3 SV=1 993 1206 3.0E-19
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 1 639 7.0E-19
sp|Q9C5Y4|SMC21_ARATH Structural maintenance of chromosomes protein 2-1 OS=Arabidopsis thaliana GN=SMC2-1 PE=2 SV=2 1 639 2.0E-18
sp|Q73VM3|SMC_MYCPA Chromosome partition protein Smc OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=smc PE=3 SV=2 998 1190 2.0E-18
sp|B9E1H0|SMC_CLOK1 Chromosome partition protein Smc OS=Clostridium kluyveri (strain NBRC 12016) GN=smc PE=3 SV=1 2 738 3.0E-18
sp|Q24U48|SMC_DESHY Chromosome partition protein Smc OS=Desulfitobacterium hafniense (strain Y51) GN=smc PE=3 SV=1 1000 1206 3.0E-18
sp|C4ZJU1|SMC_THASP Chromosome partition protein Smc OS=Thauera sp. (strain MZ1T) GN=smc PE=3 SV=2 986 1206 6.0E-18
sp|Q1INB1|SMC_KORVE Chromosome partition protein Smc OS=Koribacter versatilis (strain Ellin345) GN=smc PE=3 SV=1 1000 1190 1.0E-17
sp|Q9HK21|SMC_THEAC Chromosome partition protein Smc OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=smc PE=3 SV=1 2 753 1.0E-17
sp|A9II65|SMC_BORPD Chromosome partition protein Smc OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=smc PE=3 SV=2 987 1206 2.0E-17
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 993 1189 2.0E-17
sp|E1X022|SMC_HALMS Chromosome partition protein Smc OS=Halobacteriovorax marinus (strain ATCC BAA-682 / DSM 15412 / SJ) GN=smc PE=3 SV=2 1055 1206 3.0E-17
sp|Q8KBS6|SMC_CHLTE Chromosome partition protein Smc OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=smc PE=3 SV=1 1006 1195 7.0E-17
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 993 1189 9.0E-17
sp|P41508|SMC_MYCHR Chromosome partition protein Smc OS=Mycoplasma hyorhinis GN=smc PE=1 SV=2 996 1190 1.0E-16
sp|Q8REH4|SMC_FUSNN Chromosome partition protein Smc OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=smc PE=3 SV=2 122 670 2.0E-16
sp|P50533|SMC2_XENLA Structural maintenance of chromosomes protein 2 OS=Xenopus laevis GN=smc2 PE=1 SV=1 991 1187 4.0E-15
sp|A3PMS2|SMC_RHOS1 Chromosome partition protein Smc OS=Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9) GN=smc PE=3 SV=2 983 1208 7.0E-15
sp|P15016|YAT3_RHORU Uncharacterized protein in ATPase CF(0) subunits 3'region (Fragment) OS=Rhodospirillum rubrum PE=4 SV=1 1079 1190 8.0E-15
sp|Q9HK21|SMC_THEAC Chromosome partition protein Smc OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=smc PE=3 SV=1 1035 1190 2.0E-14
sp|B8GZ28|SMC_CAUCN Chromosome partition protein Smc OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=smc PE=1 SV=1 983 1206 3.0E-14
sp|Q59037|SMC_METJA Chromosome partition protein Smc OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=smc PE=3 SV=2 122 680 3.0E-14
sp|Q88WJ9|SMC_LACPL Chromosome partition protein Smc OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=smc PE=3 SV=1 489 639 4.0E-13
sp|Q6N1B7|SMC_RHOPA Chromosome partition protein Smc OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=smc PE=3 SV=2 991 1206 6.0E-13
sp|Q8REH4|SMC_FUSNN Chromosome partition protein Smc OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=smc PE=3 SV=2 1006 1205 8.0E-13
sp|P41003|SMC2_SCHPO Structural maintenance of chromosomes protein 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cut14 PE=1 SV=2 984 1190 2.0E-12
sp|O93309|SMC3_XENLA Structural maintenance of chromosomes protein 3 OS=Xenopus laevis GN=smc3 PE=1 SV=2 989 1190 2.0E-12
sp|B2FDA8|SMC3_CAEEL Structural maintenance of chromosomes protein 3 OS=Caenorhabditis elegans GN=smc-3 PE=1 SV=1 989 1190 1.0E-11
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 1112 1187 1.0E-11
sp|Q09591|MIX1_CAEEL Mitotic chromosome and X-chromosome-associated protein mix-1 OS=Caenorhabditis elegans GN=mix-1 PE=1 SV=2 1 757 3.0E-11
sp|Q552D9|SMC3_DICDI Structural maintenance of chromosomes protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 965 1184 4.0E-11
sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 1112 1205 4.0E-11
sp|P48996|DPY27_CAEEL Chromosome condensation protein dpy-27 OS=Caenorhabditis elegans GN=dpy-27 PE=1 SV=1 393 916 9.0E-11
sp|Q54PK4|SMC2_DICDI Structural maintenance of chromosomes protein 2 OS=Dictyostelium discoideum GN=smc2 PE=3 SV=1 1 642 2.0E-10
sp|Q9CW03|SMC3_MOUSE Structural maintenance of chromosomes protein 3 OS=Mus musculus GN=Smc3 PE=1 SV=2 989 1190 2.0E-10
sp|Q00737|SUDA_EMENI Chromosome segregation protein sudA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=sudA PE=2 SV=3 499 639 2.0E-10
sp|Q5R4K5|SMC3_PONAB Structural maintenance of chromosomes protein 3 OS=Pongo abelii GN=SMC3 PE=2 SV=1 989 1190 2.0E-10
sp|Q9UQE7|SMC3_HUMAN Structural maintenance of chromosomes protein 3 OS=Homo sapiens GN=SMC3 PE=1 SV=2 989 1190 2.0E-10
sp|O97594|SMC3_BOVIN Structural maintenance of chromosomes protein 3 OS=Bos taurus GN=SMC3 PE=1 SV=1 1097 1190 3.0E-10
sp|P47037|SMC3_YEAST Structural maintenance of chromosomes protein 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC3 PE=1 SV=1 987 1198 5.0E-10
sp|P97690|SMC3_RAT Structural maintenance of chromosomes protein 3 OS=Rattus norvegicus GN=Smc3 PE=1 SV=1 1097 1189 4.0E-09
sp|Q9SN90|SMC22_ARATH Structural maintenance of chromosomes protein 2-2 OS=Arabidopsis thaliana GN=SMC2-2 PE=2 SV=1 1112 1202 5.0E-09
sp|Q56YN8|SMC3_ARATH Structural maintenance of chromosomes protein 3 OS=Arabidopsis thaliana GN=SMC3 PE=2 SV=1 486 639 3.0E-08
sp|Q7ZAK1|SMC_THEEB Chromosome partition protein Smc OS=Thermosynechococcus elongatus (strain BP-1) GN=smc PE=3 SV=1 497 639 6.0E-08
sp|Q8I1U7|SMC3_PLAF7 Structural maintenance of chromosomes protein 3 homolog OS=Plasmodium falciparum (isolate 3D7) GN=PFD0685c PE=3 SV=1 1112 1190 3.0E-07
sp|P47540|SMC_MYCGE Chromosome partition protein Smc OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=smc PE=3 SV=1 497 639 7.0E-07
sp|Q552D9|SMC3_DICDI Structural maintenance of chromosomes protein 3 OS=Dictyostelium discoideum GN=smc3 PE=3 SV=1 499 639 2.0E-06
sp|P38989|SMC2_YEAST Structural maintenance of chromosomes protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SMC2 PE=1 SV=1 1 226 2.0E-06
sp|P75361|SMC_MYCPN Chromosome partition protein Smc OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=smc PE=3 SV=1 512 697 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005524 ATP binding Yes
GO:0051276 chromosome organization Yes
GO:0005694 chromosome Yes
GO:0005515 protein binding Yes
GO:0071840 cellular component organization or biogenesis No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0030554 adenyl nucleotide binding No
GO:0043226 organelle No
GO:0043229 intracellular organelle No
GO:1901363 heterocyclic compound binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0110165 cellular anatomical entity No
GO:0097159 organic cyclic compound binding No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0036094 small molecule binding No
GO:0032553 ribonucleotide binding No
GO:0032555 purine ribonucleotide binding No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043167 ion binding No
GO:0017076 purine nucleotide binding No
GO:0043228 non-membrane-bounded organelle No
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005488 binding No
GO:0006996 organelle organization No
GO:0016043 cellular component organization No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5119
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1155
Ophiocordyceps australis map64 (Brazil) OphauB2|5088
Ophiocordyceps camponoti-floridani Ophcf2|06066
Ophiocordyceps camponoti-rufipedis Ophun1|6594 (this protein)
Ophiocordyceps kimflemingae Ophio5|7984
Ophiocordyceps subramaniannii Hirsu2|3375

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6594
MDAISFVLGIKSSHLRSAHLKDLVYRGRVLKTSKINDDGSAEAKEGANGLSDVNARASRGDPKTAWVMAVYEDDA
GEEQRWKRSITNQGASEYRINERVVTAQQYNEALESENILIKARNFLVFQGDVEAIASQSPQDLTRLIEQISGSL
EYKVEYERLQVDAEQALENQNFQLHRRRGINSEIKQYREQKKEADSFQKKTEERDRSIVAHCLWKLYHFQKTMDE
SSAAIQAHQEDLKELRRNAETFEMRLEAARREQISTGRLVAGAEKQTKMIKKSIEDGENALVPVDEKILETSQEI
EKLQVQSQKISKELDDQTEVVQKVQKDMEKIDKAQETYETGIREQMKEQGRDISEADRKEYDVLRAQVMSRCSSN
QSKLENLERQRKADEITVNNLRGKIDTIQAAVRKVETELASTTERQSFAESAAKGIADDIAVKKKEFNQLQSERV
RTNQKRTELEEKLEDVARKLREADDGRRQSDREIRMRDMVTSLKRVFPGVRGRIGELCTPKQKKYDEAVIVALGR
DFDSIVVDTERIGVDCVQFLKEQRFPPTTFIPLDNIKVNAVNSAIKGVSGARLTIDTVNFDPSVERAVSYACGSS
VVCDTLDVAKNICYEKKLGVKAVTLEGYIIHKAGLMTGGRGPEAKVGKRKFEEADVQNLQRMATTLREEIDRLPK
ADRRGHHEESLQIELAGLERHLATTREEIAALTKNCASKKRELGAYKNQLQERQPRYEEQASQLASIAETVQEFR
DAIARVEDDVFAGFCQRLGYGDIRSYEASQGKFEQEVFEKRSQFEVQKQRLEQRLNWEVTRHADTETRIRRVKEK
VRRLKQDVKSYMNEKSDVGEALSIKRDELEVLRQTLDEHKSELAKRNQEVSLARSEVQKRSKGIEALQRDISGLE
TTVQKNSATKSALLRRCRLEQIPIPLKEGTLDDLPNEDDLLRQDPDAMDVDEDEEMMGIALDDHGIEINFDDLED
ELKESDDPSIEDGLMQNIAKLTAELEKLNPNMRAMDRLESVESRLKQTDQEYEDSKAAAQAAKEAFSSVKQQRYN
LFNKAFSHIAEQISHVYRDLTRSEAYPLGGQAYLDIEEDTDMPYLSGIKYHAMPPLKRFRDMEHLSGGEKTMAAL
ALLFAIHSYQPSPFFVLDEVDAALDNANVDKIKKYIREHSGPGMQFIVISLKTGLFQDSESLVGVYRDQEVNSSR
TLTLDLRRYA*
Coding >Ophun1|6594
ATGGATGCGATCTCCTTCGTCCTCGGCATTAAGTCGTCTCATTTACGTTCGGCCCATCTCAAAGATCTTGTCTAC
CGTGGACGGGTTCTGAAAACGTCCAAGATCAACGACGATGGATCTGCCGAGGCCAAGGAAGGCGCAAACGGTCTA
TCCGACGTAAATGCGCGAGCTTCGCGGGGCGATCCCAAAACTGCATGGGTGATGGCGGTATATGAAGACGATGCT
GGTGAGGAGCAGAGATGGAAGCGGTCCATCACGAACCAAGGCGCAAGCGAGTATCGCATCAACGAACGCGTTGTC
ACTGCCCAGCAATACAACGAAGCTCTCGAGTCTGAAAATATTTTGATCAAAGCTCGCAACTTCCTCGTCTTTCAA
GGGGATGTTGAAGCAATCGCATCGCAGTCCCCACAGGACCTCACGCGCCTCATTGAGCAGATATCTGGGAGCCTG
GAGTACAAAGTTGAATACGAAAGACTCCAGGTGGACGCAGAGCAGGCCTTGGAGAACCAAAATTTCCAACTTCAC
AGACGACGTGGAATCAATTCGGAGATCAAGCAGTATCGTGAGCAAAAGAAAGAGGCTGATAGCTTTCAGAAGAAG
ACAGAGGAAAGAGACCGGTCAATTGTTGCCCACTGTCTGTGGAAGCTGTACCATTTCCAAAAGACTATGGATGAG
TCCAGCGCTGCCATTCAAGCCCATCAGGAAGACCTCAAGGAGCTGAGGCGCAATGCTGAGACTTTCGAGATGCGT
CTTGAAGCCGCGCGAAGAGAACAGATTTCAACAGGCCGCCTCGTCGCAGGAGCTGAGAAGCAAACAAAAATGATC
AAGAAAAGCATAGAGGATGGCGAAAATGCACTGGTACCTGTGGACGAAAAGATTCTGGAGACTTCTCAAGAGATT
GAAAAGTTGCAGGTTCAGAGTCAAAAGATCTCCAAGGAACTCGACGACCAGACTGAAGTAGTCCAAAAGGTCCAG
AAGGACATGGAAAAAATTGACAAGGCCCAGGAGACTTATGAAACAGGCATTAGGGAGCAGATGAAGGAGCAGGGA
CGAGACATCAGCGAAGCAGACCGAAAAGAGTACGATGTCTTGCGAGCGCAAGTCATGTCGCGCTGCAGCAGTAAT
CAGTCTAAGCTCGAGAATCTTGAAAGACAACGCAAGGCCGACGAGATTACCGTCAACAACCTCAGGGGCAAGATT
GATACAATTCAGGCGGCCGTCCGAAAGGTTGAGACTGAGCTAGCGAGCACGACAGAACGGCAGAGTTTCGCAGAA
AGTGCAGCCAAAGGAATAGCCGATGATATCGCCGTCAAGAAGAAGGAGTTCAACCAACTTCAGTCGGAGCGGGTG
CGAACGAACCAAAAGCGAACGGAGTTGGAGGAGAAGCTTGAGGATGTGGCCCGGAAGCTTAGAGAAGCTGACGAT
GGTCGTCGTCAAAGTGATCGCGAGATTCGAATGAGGGATATGGTGACATCCTTGAAACGAGTGTTTCCCGGAGTT
CGTGGCCGCATTGGCGAGCTTTGTACTCCCAAACAGAAGAAGTACGACGAAGCAGTCATTGTCGCCCTCGGGCGA
GATTTCGACTCAATCGTCGTCGACACCGAGAGGATTGGGGTAGACTGTGTTCAGTTCCTGAAGGAACAGAGGTTT
CCGCCCACGACATTTATTCCCCTGGATAACATCAAAGTCAATGCTGTTAACTCGGCGATCAAGGGGGTCTCTGGG
GCCAGGCTGACCATTGACACCGTCAACTTTGACCCGTCAGTGGAAAGGGCTGTGTCCTACGCGTGCGGCAGTTCG
GTCGTATGTGATACGCTTGACGTTGCGAAAAACATCTGCTATGAGAAGAAACTGGGCGTGAAAGCAGTGACGCTT
GAGGGCTACATCATCCATAAAGCTGGACTCATGACTGGTGGTCGCGGTCCCGAAGCCAAAGTGGGAAAACGCAAG
TTTGAAGAAGCCGACGTTCAGAACCTGCAGCGAATGGCAACGACATTACGAGAAGAGATAGATCGTTTGCCGAAA
GCGGATAGGCGTGGTCATCATGAGGAGTCGCTCCAGATTGAGCTTGCCGGGCTCGAGCGCCATCTCGCAACGACT
AGGGAAGAGATTGCAGCATTGACCAAGAATTGCGCCAGCAAGAAACGTGAACTTGGCGCATATAAGAATCAGCTG
CAAGAGCGGCAGCCCCGGTACGAAGAGCAAGCCTCGCAGCTCGCTAGCATCGCAGAGACGGTGCAGGAGTTCCGG
GATGCGATTGCTCGAGTCGAAGATGATGTATTCGCCGGATTTTGCCAACGGCTCGGCTACGGCGACATACGATCT
TACGAGGCTTCGCAAGGTAAATTCGAACAGGAAGTCTTCGAAAAGCGGAGTCAATTCGAGGTTCAGAAGCAAAGG
TTGGAGCAAAGACTAAACTGGGAGGTCACTCGTCACGCGGACACAGAGACACGGATAAGACGAGTAAAAGAAAAG
GTGCGACGATTGAAGCAGGATGTCAAGTCCTACATGAACGAAAAGTCGGATGTCGGGGAGGCCTTGAGCATCAAA
CGGGATGAATTAGAGGTCTTGCGTCAGACTCTAGACGAGCACAAGTCGGAGCTCGCCAAGAGGAACCAGGAGGTC
AGCCTGGCTCGATCAGAGGTGCAAAAGCGCAGCAAGGGCATCGAAGCTCTTCAACGAGATATAAGCGGTCTCGAA
ACGACGGTCCAGAAGAACAGCGCTACCAAATCGGCTTTGCTTCGAAGATGTCGACTGGAACAGATCCCAATCCCT
TTGAAGGAGGGAACGCTTGATGATCTTCCCAACGAGGACGACCTGTTACGGCAAGATCCGGACGCAATGGACGTG
GACGAAGATGAGGAAATGATGGGTATCGCCCTCGACGATCACGGCATCGAGATCAATTTCGATGATTTAGAGGAC
GAGTTGAAGGAGTCCGACGATCCTAGTATCGAAGACGGTTTGATGCAGAATATTGCCAAACTCACCGCAGAGTTG
GAAAAATTGAACCCCAATATGCGTGCCATGGATCGTCTGGAAAGTGTAGAGTCGAGGCTCAAGCAGACGGATCAG
GAATACGAAGACTCTAAAGCGGCTGCGCAGGCCGCAAAGGAAGCCTTCAGCAGCGTGAAACAGCAGCGATATAAT
CTGTTCAACAAAGCATTCAGTCATATCGCGGAGCAGATCTCGCACGTCTACAGAGATCTCACACGTTCAGAGGCG
TACCCCCTCGGTGGCCAGGCATACCTAGATATCGAGGAAGACACTGATATGCCCTATCTATCGGGCATCAAGTAT
CACGCCATGCCCCCTCTGAAGCGATTTCGAGACATGGAGCACCTGTCCGGAGGAGAAAAAACCATGGCGGCTCTC
GCTCTTCTCTTCGCTATCCACAGTTACCAGCCGAGCCCTTTCTTCGTTTTGGACGAGGTCGACGCTGCCCTGGAC
AACGCCAATGTCGATAAAATCAAGAAGTACATACGAGAACACTCCGGTCCAGGTATGCAGTTCATTGTCATCAGT
CTCAAGACCGGTCTATTCCAGGACTCGGAGAGTTTGGTAGGCGTCTATCGAGATCAAGAGGTGAACAGCTCTAGG
ACGCTTACATTGGATTTGCGGAGGTACGCATAA
Transcript >Ophun1|6594
ATGGATGCGATCTCCTTCGTCCTCGGCATTAAGTCGTCTCATTTACGTTCGGCCCATCTCAAAGATCTTGTCTAC
CGTGGACGGGTTCTGAAAACGTCCAAGATCAACGACGATGGATCTGCCGAGGCCAAGGAAGGCGCAAACGGTCTA
TCCGACGTAAATGCGCGAGCTTCGCGGGGCGATCCCAAAACTGCATGGGTGATGGCGGTATATGAAGACGATGCT
GGTGAGGAGCAGAGATGGAAGCGGTCCATCACGAACCAAGGCGCAAGCGAGTATCGCATCAACGAACGCGTTGTC
ACTGCCCAGCAATACAACGAAGCTCTCGAGTCTGAAAATATTTTGATCAAAGCTCGCAACTTCCTCGTCTTTCAA
GGGGATGTTGAAGCAATCGCATCGCAGTCCCCACAGGACCTCACGCGCCTCATTGAGCAGATATCTGGGAGCCTG
GAGTACAAAGTTGAATACGAAAGACTCCAGGTGGACGCAGAGCAGGCCTTGGAGAACCAAAATTTCCAACTTCAC
AGACGACGTGGAATCAATTCGGAGATCAAGCAGTATCGTGAGCAAAAGAAAGAGGCTGATAGCTTTCAGAAGAAG
ACAGAGGAAAGAGACCGGTCAATTGTTGCCCACTGTCTGTGGAAGCTGTACCATTTCCAAAAGACTATGGATGAG
TCCAGCGCTGCCATTCAAGCCCATCAGGAAGACCTCAAGGAGCTGAGGCGCAATGCTGAGACTTTCGAGATGCGT
CTTGAAGCCGCGCGAAGAGAACAGATTTCAACAGGCCGCCTCGTCGCAGGAGCTGAGAAGCAAACAAAAATGATC
AAGAAAAGCATAGAGGATGGCGAAAATGCACTGGTACCTGTGGACGAAAAGATTCTGGAGACTTCTCAAGAGATT
GAAAAGTTGCAGGTTCAGAGTCAAAAGATCTCCAAGGAACTCGACGACCAGACTGAAGTAGTCCAAAAGGTCCAG
AAGGACATGGAAAAAATTGACAAGGCCCAGGAGACTTATGAAACAGGCATTAGGGAGCAGATGAAGGAGCAGGGA
CGAGACATCAGCGAAGCAGACCGAAAAGAGTACGATGTCTTGCGAGCGCAAGTCATGTCGCGCTGCAGCAGTAAT
CAGTCTAAGCTCGAGAATCTTGAAAGACAACGCAAGGCCGACGAGATTACCGTCAACAACCTCAGGGGCAAGATT
GATACAATTCAGGCGGCCGTCCGAAAGGTTGAGACTGAGCTAGCGAGCACGACAGAACGGCAGAGTTTCGCAGAA
AGTGCAGCCAAAGGAATAGCCGATGATATCGCCGTCAAGAAGAAGGAGTTCAACCAACTTCAGTCGGAGCGGGTG
CGAACGAACCAAAAGCGAACGGAGTTGGAGGAGAAGCTTGAGGATGTGGCCCGGAAGCTTAGAGAAGCTGACGAT
GGTCGTCGTCAAAGTGATCGCGAGATTCGAATGAGGGATATGGTGACATCCTTGAAACGAGTGTTTCCCGGAGTT
CGTGGCCGCATTGGCGAGCTTTGTACTCCCAAACAGAAGAAGTACGACGAAGCAGTCATTGTCGCCCTCGGGCGA
GATTTCGACTCAATCGTCGTCGACACCGAGAGGATTGGGGTAGACTGTGTTCAGTTCCTGAAGGAACAGAGGTTT
CCGCCCACGACATTTATTCCCCTGGATAACATCAAAGTCAATGCTGTTAACTCGGCGATCAAGGGGGTCTCTGGG
GCCAGGCTGACCATTGACACCGTCAACTTTGACCCGTCAGTGGAAAGGGCTGTGTCCTACGCGTGCGGCAGTTCG
GTCGTATGTGATACGCTTGACGTTGCGAAAAACATCTGCTATGAGAAGAAACTGGGCGTGAAAGCAGTGACGCTT
GAGGGCTACATCATCCATAAAGCTGGACTCATGACTGGTGGTCGCGGTCCCGAAGCCAAAGTGGGAAAACGCAAG
TTTGAAGAAGCCGACGTTCAGAACCTGCAGCGAATGGCAACGACATTACGAGAAGAGATAGATCGTTTGCCGAAA
GCGGATAGGCGTGGTCATCATGAGGAGTCGCTCCAGATTGAGCTTGCCGGGCTCGAGCGCCATCTCGCAACGACT
AGGGAAGAGATTGCAGCATTGACCAAGAATTGCGCCAGCAAGAAACGTGAACTTGGCGCATATAAGAATCAGCTG
CAAGAGCGGCAGCCCCGGTACGAAGAGCAAGCCTCGCAGCTCGCTAGCATCGCAGAGACGGTGCAGGAGTTCCGG
GATGCGATTGCTCGAGTCGAAGATGATGTATTCGCCGGATTTTGCCAACGGCTCGGCTACGGCGACATACGATCT
TACGAGGCTTCGCAAGGTAAATTCGAACAGGAAGTCTTCGAAAAGCGGAGTCAATTCGAGGTTCAGAAGCAAAGG
TTGGAGCAAAGACTAAACTGGGAGGTCACTCGTCACGCGGACACAGAGACACGGATAAGACGAGTAAAAGAAAAG
GTGCGACGATTGAAGCAGGATGTCAAGTCCTACATGAACGAAAAGTCGGATGTCGGGGAGGCCTTGAGCATCAAA
CGGGATGAATTAGAGGTCTTGCGTCAGACTCTAGACGAGCACAAGTCGGAGCTCGCCAAGAGGAACCAGGAGGTC
AGCCTGGCTCGATCAGAGGTGCAAAAGCGCAGCAAGGGCATCGAAGCTCTTCAACGAGATATAAGCGGTCTCGAA
ACGACGGTCCAGAAGAACAGCGCTACCAAATCGGCTTTGCTTCGAAGATGTCGACTGGAACAGATCCCAATCCCT
TTGAAGGAGGGAACGCTTGATGATCTTCCCAACGAGGACGACCTGTTACGGCAAGATCCGGACGCAATGGACGTG
GACGAAGATGAGGAAATGATGGGTATCGCCCTCGACGATCACGGCATCGAGATCAATTTCGATGATTTAGAGGAC
GAGTTGAAGGAGTCCGACGATCCTAGTATCGAAGACGGTTTGATGCAGAATATTGCCAAACTCACCGCAGAGTTG
GAAAAATTGAACCCCAATATGCGTGCCATGGATCGTCTGGAAAGTGTAGAGTCGAGGCTCAAGCAGACGGATCAG
GAATACGAAGACTCTAAAGCGGCTGCGCAGGCCGCAAAGGAAGCCTTCAGCAGCGTGAAACAGCAGCGATATAAT
CTGTTCAACAAAGCATTCAGTCATATCGCGGAGCAGATCTCGCACGTCTACAGAGATCTCACACGTTCAGAGGCG
TACCCCCTCGGTGGCCAGGCATACCTAGATATCGAGGAAGACACTGATATGCCCTATCTATCGGGCATCAAGTAT
CACGCCATGCCCCCTCTGAAGCGATTTCGAGACATGGAGCACCTGTCCGGAGGAGAAAAAACCATGGCGGCTCTC
GCTCTTCTCTTCGCTATCCACAGTTACCAGCCGAGCCCTTTCTTCGTTTTGGACGAGGTCGACGCTGCCCTGGAC
AACGCCAATGTCGATAAAATCAAGAAGTACATACGAGAACACTCCGGTCCAGGTATGCAGTTCATTGTCATCAGT
CTCAAGACCGGTCTATTCCAGGACTCGGAGAGTTTGGTAGGCGTCTATCGAGATCAAGAGGTGAACAGCTCTAGG
ACGCTTACATTGGATTTGCGGAGGTACGCATAA
Gene >Ophun1|6594
ATGGATGCGATCTCCTTCGTCCTCGGCATTAAGTCGTCTCATTTACGTTCGGCCCATCTCAAAGATCTTGTCTAC
CGTGGACGGGTTCTGAAAACGTCCAAGATCAACGACGATGGATCTGCCGAGGCCAAGGAAGGCGCAAACGGTCTA
TCCGACGTAAATGCGCGAGCTTCGCGGGGCGATCCCAAAACTGCATGGGTGATGGCGGTATATGAAGACGATGCT
GGTGAGGAGCAGAGATGGAAGCGGTCCATCACGAACCAAGGCGCAAGCGAGTATCGCATCAACGAACGCGTTGTC
ACTGCCCAGCAATACAACGAAGCTCTCGAGTCTGAAAATATTTTGATCAAAGCTCGCAACTTCCTCGTCTTTCAA
GGGGATGTTGAAGCAATCGCATCGCAGTCCCCACAGGACCTCACGCGCCTCATTGAGCAGATATCTGGGAGCCTG
GAGTACAAAGTTGAATACGAAAGACTCCAGGTGGACGCAGAGCAGGCCTTGGAGAACCAAAATTTCCAACTTCAC
AGACGACGTGGAATCAATTCGGAGATCAAGCAGTATCGTGAGCAAAAGAAAGAGGCTGATAGCTTTCAGAAGAAG
ACAGAGGAAAGAGACCGGTCAATTGTTGCCCACTGTCTGTGGAAGCTGTACCATTTCCAAAAGACTATGGATGAG
TCCAGCGCTGCCATTCAAGCCCATCAGGAAGACCTCAAGGAGCTGAGGCGCAATGCTGAGACTTTCGAGATGCGT
CTTGAAGCCGCGCGAAGAGAACAGATTTCAACAGGCCGCCTCGTCGCAGGAGCTGAGAAGCAAACAAAAATGATC
AAGAAAAGCATAGAGGATGGCGAAAATGCACTGGTACCTGTGGACGAAAAGATTCTGGAGACTTCTCAAGAGATT
GAAAAGTTGCAGGTTCAGAGTCAAAAGATCTCCAAGGAACTCGACGACCAGACTGAAGTAGTCCAAAAGGTCCAG
AAGGACATGGAAAAAATTGACAAGGCCCAGGAGACTTATGAAACAGGCATTAGGGAGCAGATGAAGGAGCAGGGA
CGAGACATCAGCGAAGCAGACCGAAAAGAGTACGATGTCTTGCGAGCGCAAGTCATGTCGCGCTGCAGCAGTAAT
CAGTCTAAGCTCGAGAATCTTGAAAGACAACGCAAGGCCGACGAGATTACCGTCAACAACCTCAGGGGCAAGATT
GATACAATTCAGGCGGCCGTCCGAAAGGTTGAGACTGAGCTAGCGAGCACGACAGAACGGCAGAGTTTCGCAGAA
AGTGCAGCCAAAGGAATAGCCGATGATATCGCCGTCAAGAAGAAGGAGTTCAACCAACTTCAGTCGGAGCGGGTG
CGAACGAACCAAAAGCGAACGGAGTTGGAGGAGAAGCTTGAGGATGTGGCCCGGAAGCTTAGAGAAGCTGACGAT
GGTCGTCGTCAAAGTGATCGCGAGATTCGAATGAGGGATATGGTGACATCCTTGAAACGAGTGTTTCCCGGAGTT
CGTGGCCGCATTGGCGAGCTTTGTACTCCCAAACAGAAGAAGTACGACGAAGCAGTCATTGTCGCCCTCGGGCGA
GATTTCGACTCAATCGTCGTCGACACCGAGAGGATTGGGGTAGACTGTGTTCAGTTCCTGAAGGAACAGAGGTTT
CCGCCCACGACATTTATTCCCCTGGATAACATCAAAGTCAATGCTGTTAACTCGGCGATCAAGGGGGTCTCTGGG
GCCAGGCTGACCATTGACACCGTCAACTTTGACCCGTCAGTGGAAAGGGCTGTGTCCTACGCGTGCGGCAGTTCG
GTCGTATGTGATACGCTTGACGTTGCGAAAAACATCTGCTATGAGAAGAAACTGGGCGTGAAAGCAGTGACGCTT
GAGGGCTACATCATCCATAAAGCTGGACTCATGACTGGTGGTCGCGGTCCCGAAGCCAAAGTGGGAAAACGCAAG
TTTGAAGAAGCCGACGTTCAGAACCTGCAGCGAATGGCAACGACATTACGAGAAGAGATAGATCGTTTGCCGAAA
GCGGATAGGCGTGGTCATCATGAGGAGTCGCTCCAGATTGAGCTTGCCGGGCTCGAGCGCCATCTCGCAACGACT
AGGGAAGAGATTGCAGCATTGACCAAGAATTGCGCCAGCAAGAAACGTGAACTTGGCGCATATAAGAATCAGCTG
CAAGAGCGGCAGCCCCGGTACGAAGAGCAAGCCTCGCAGCTCGCTAGCATCGCAGAGACGGTGCAGGAGTTCCGG
GATGCGATTGCTCGAGTCGAAGATGATGTATTCGCCGGATTTTGCCAACGGCTCGGCTACGGCGACATACGATCT
TACGAGGCTTCGCAAGGTAAATTCGAACAGGAAGTCTTCGAAAAGCGGAGTCAATTCGAGGTTCAGAAGCAAAGG
TTGGAGCAAAGACTAAACTGGGAGGTCACTCGTCACGCGGACACAGAGACACGGATAAGACGAGTAAAAGAAAAG
GTGCGACGATTGAAGCAGGATGTCAAGTCCTACATGAACGAAAAGTCGGATGTCGGGGAGGCCTTGAGCATCAAA
CGGGATGAATTAGAGGTCTTGCGTCAGACTCTAGACGAGCACAAGTCGGAGCTCGCCAAGAGGAACCAGGAGGTC
AGCCTGGCTCGATCAGAGGTGCAAAAGCGCAGCAAGGGCATCGAAGCTCTTCAACGAGATATAAGCGGTCTCGAA
ACGACGGTCCAGAAGAACAGCGCTACCAAATCGGCTTTGCTTCGAAGATGTCGACTGGAACAGATCCCAATCCCT
TTGAAGGAGGGAACGCTTGATGATCTTCCCAACGAGGACGACCTGTTACGGCAAGATCCGGACGCAATGGACGTG
GACGAAGATGAGGAAATGATGGGTATCGCCCTCGACGATCACGGCATCGAGATCAATTTCGATGATTTAGAGGAC
GAGTTGAAGGAGGTGAGTAGGAATTACCGTAGCAATCGTGGGCGCAGGCTAACCCGATTCCAGTCCGACGATCCT
AGTATCGAAGACGGTTTGATGCAGAATATTGCCAAACTCACCGCAGAGTTGGAAAAATTGAACCCCAATATGCGT
GCCATGGATCGTCTGGAAAGTGTAGAGTCGAGGCTCAAGCAGACGGATCAGGAATACGAAGACTCTAAAGCGGCT
GCGCAGGCCGCAAAGGAAGCCTTCAGCAGCGTGAAACAGCAGCGATATAATCTGTTCAACAAAGCATTCAGTCAT
ATCGCGGAGCAGATCTCGCACGTCTACAGAGATCTCACACGTTCAGAGGCGTACCCCCTCGGTGGCCAGGCATAC
CTAGATATCGAGGAAGACACTGATATGCCCTATCTATCGGGCATCAAGTATCACGCCATGCCCCCTCTGAAGCGA
TTTCGAGACATGGAGCACCTGTCCGGAGGAGAAAAAACCATGGCGGCTCTCGCTCTTCTCTTCGCTATCCACAGT
TACCAGCCGAGCCCTTTCTTCGTTTTGGACGAGGTCGACGCTGCCCTGGACAACGCCAATGTCGATAAAATCAAG
AAGTACATACGAGAACACTCCGGTCCAGGTATGCAGTTCATTGTCATCAGTCTCAAGACCGGTCTATTCCAGGAC
TCGGAGAGTTTGGTAGGCGTCTATCGAGATCAAGAGGTGAACAGCTCTAGGACGCTTACATTGGATGTGAGTCCC
CCCCGCCCCCCAAACTCATCTTCTCGTACCTCGCTGACTCTTTTGGACTAGTTGCGGAGGTACGCATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail