Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6592
Gene name
LocationContig_73:32458..34772
Strand+
Gene length (bp)2314
Transcript length (bp)1767
Coding sequence length (bp)1767
Protein length (aa) 589

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13844 Glyco_transf_41 Glycosyl transferase family 41 6.4E-21 231 287
PF13844 Glyco_transf_41 Glycosyl transferase family 41 1.8E-47 360 565
PF13181 TPR_8 Tetratricopeptide repeat 8.0E-04 17 42
PF13181 TPR_8 Tetratricopeptide repeat 2.1E-01 51 81

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 214 581 2.0E-62
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 360 585 4.0E-42
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 360 585 5.0E-42
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 360 585 7.0E-42
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 360 585 1.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 214 581 2.0E-62
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 360 585 4.0E-42
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 360 585 5.0E-42
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 360 585 7.0E-42
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 360 585 1.0E-41
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 360 585 2.0E-40
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 361 585 5.0E-37
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 1 332 3.0E-30
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 1 332 3.0E-30
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 1 332 3.0E-30
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 1 332 4.0E-30
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 1 332 5.0E-30
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 3 387 2.0E-27
sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 1 581 2.0E-22
sp|Q8LP10|SPY_EUSER Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Eustoma exaltatum subsp. russellianum GN=SPY PE=2 SV=1 7 581 4.0E-21
sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 1 581 7.0E-21
sp|Q8RVB2|SPY_SOLLC Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Solanum lycopersicum GN=SPY PE=2 SV=1 1 581 3.0E-20
sp|A8BFN4|OGT1_GIAIC UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Giardia intestinalis (strain ATCC 50803 / WB clone C6) GN=GL50803_12081 PE=1 SV=1 360 581 8.0E-16
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 4 106 1.0E-10
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 1 93 1.0E-07
sp|O18158|OGT1_CAEEL UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase OS=Caenorhabditis elegans GN=ogt-1 PE=1 SV=2 4 89 2.0E-07
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 1 93 2.0E-07
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 1 93 2.0E-07
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 1 93 2.0E-07
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 1 93 2.0E-07
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 1 93 2.0E-07
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 4 89 4.0E-07
sp|Q9M8Y0|SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana GN=SEC PE=2 SV=1 7 102 7.0E-07
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 4 101 1.0E-06
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 4 101 1.0E-06
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 4 101 1.0E-06
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 4 101 1.0E-06
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 4 101 1.0E-06
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 1 89 2.0E-06
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 1 89 2.0E-06
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 1 89 2.0E-06
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 1 89 2.0E-06
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 1 89 2.0E-06
sp|P56558|OGT1_RAT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Rattus norvegicus GN=Ogt PE=1 SV=1 4 89 3.0E-06
sp|P81436|OGT1_RABIT UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Oryctolagus cuniculus GN=OGT PE=1 SV=2 4 89 3.0E-06
sp|Q27HV0|OGT1_PIG UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Sus scrofa GN=OGT PE=2 SV=1 4 89 3.0E-06
sp|O15294|OGT1_HUMAN UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Homo sapiens GN=OGT PE=1 SV=3 4 89 3.0E-06
sp|Q8CGY8|OGT1_MOUSE UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110 kDa subunit OS=Mus musculus GN=Ogt PE=1 SV=2 4 89 3.0E-06
sp|O82422|SPY_HORVU Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Hordeum vulgare GN=SPY PE=2 SV=1 12 100 4.0E-06
sp|Q6YZI0|SPY_ORYSJ Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Oryza sativa subsp. japonica GN=SPY PE=3 SV=1 12 100 5.0E-06
sp|O82039|SPY_PETHY Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Petunia hybrida GN=SPY PE=2 SV=1 12 92 8.0E-06
sp|Q96301|SPY_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SPINDLY OS=Arabidopsis thaliana GN=SPY PE=1 SV=1 12 92 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup5075
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|562
Ophiocordyceps australis map64 (Brazil) OphauB2|4588
Ophiocordyceps camponoti-floridani Ophcf2|06070
Ophiocordyceps camponoti-rufipedis Ophun1|6592 (this protein)
Ophiocordyceps kimflemingae Ophio5|7555
Ophiocordyceps subramaniannii Hirsu2|2911

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6592
MAYYHYGLRLDPNHVHLHTNLGSLLKDMGQLDRAIQMYERAVLCDGTFDIALTNLANAVKDKGRIVDAIAYYRRA
VYSNPEFDEAVCGLFLALNSVCNWRGRGGVLLTPGGYDRWHVDDEGKILDARIQGGARGLAKRVVDIVTHQLRDA
SVWGQHTLQEPVIQVIEQQLRHLCEDSSFQLAPAIRRWAGKPWEGSRLTRLLERAARVALRKWYLDINYRGKELS
ASAIVRIHILVNLNGYTRGARNEIFAARPAPIQMSFMGFAGSLGAEWCDYILADKTTVPPETLRPWRRNVSIEDV
LKDDNECCEGQWAYSENVIFCRSTFFCCDHAQSSGRGEKTLPWDREKRRRWEMRRQLFPGMPDDTVILGNFNQLY
KIDPTIFRSWLRILSRVPNAILWLLRFPEPGEMNLRATAETWAGPEVAKRLIFTDVAPKDQHILRARVCDLFLDT
PECNAHTTAADVLWSSTPLLTFPRYSYKMCSRIAASILRGALPPSDPGLQVARELIVEDEMEYEKRAVDLAGRLA
YVEVTGAGYREGQGRLADMRKILWENKWQCALFDTRRWVDEVECAYEEAWRRWVNGVGGDIYL*
Coding >Ophun1|6592
ATGGCCTACTACCACTATGGCTTGCGACTCGATCCCAATCATGTCCATCTGCACACAAACCTTGGCAGCCTCTTG
AAGGACATGGGTCAGCTGGACCGTGCCATCCAGATGTACGAGCGCGCCGTATTGTGTGACGGAACGTTTGACATC
GCTCTGACGAACCTCGCCAACGCCGTCAAGGACAAGGGTCGCATCGTCGACGCTATCGCATATTACCGTCGGGCT
GTGTATTCTAATCCGGAATTCGACGAGGCCGTGTGTGGCCTCTTCTTAGCATTGAATTCTGTGTGCAATTGGCGA
GGCCGTGGAGGTGTGCTACTGACTCCGGGCGGCTACGATAGATGGCACGTTGATGATGAAGGCAAAATCCTCGAT
GCTCGGATACAAGGCGGTGCCCGGGGCTTAGCCAAGCGAGTCGTGGACATTGTTACTCATCAGCTTCGAGATGCA
TCTGTTTGGGGCCAACATACTCTTCAAGAGCCAGTCATCCAAGTCATTGAACAGCAGCTTCGGCACCTCTGCGAA
GACTCATCCTTCCAGCTCGCCCCTGCTATCCGGCGATGGGCAGGCAAGCCATGGGAAGGTTCGCGATTGACCCGT
CTGTTGGAGAGAGCTGCTCGAGTGGCTCTCCGCAAGTGGTATTTGGATATCAACTATCGTGGCAAGGAGCTTTCG
GCTTCCGCTATTGTTCGGATACACATCCTGGTGAATCTCAATGGCTACACCAGAGGTGCTCGAAACGAAATCTTT
GCTGCCAGACCAGCACCAATACAGATGTCTTTCATGGGCTTCGCGGGGAGTCTGGGTGCCGAGTGGTGCGACTAT
ATACTGGCTGATAAAACGACCGTGCCTCCTGAAACCTTACGCCCATGGCGTAGGAACGTCAGCATTGAAGACGTT
CTCAAGGATGATAACGAATGCTGCGAGGGCCAGTGGGCGTACTCCGAGAATGTCATCTTTTGCCGCAGCACATTT
TTCTGCTGCGATCACGCTCAGTCGAGTGGACGGGGTGAGAAGACCTTGCCGTGGGATAGAGAGAAGCGAAGAAGA
TGGGAAATGCGCCGACAATTGTTCCCGGGTATGCCTGACGATACCGTCATTTTGGGTAACTTTAATCAATTGTAC
AAGATCGATCCAACGATATTCCGGTCATGGCTTCGAATCCTGTCCCGCGTTCCCAATGCCATACTCTGGCTTCTG
CGATTTCCCGAGCCAGGCGAGATGAACCTGCGGGCAACGGCTGAAACGTGGGCTGGGCCTGAGGTGGCAAAGCGC
CTTATCTTCACCGATGTGGCACCCAAGGATCAGCACATACTGCGTGCTCGCGTATGCGATCTGTTCCTCGACACT
CCCGAATGTAACGCACATACAACGGCCGCGGATGTCTTGTGGTCAAGCACGCCGCTACTGACTTTCCCACGTTAC
TCTTACAAAATGTGCTCTCGCATTGCCGCCTCAATTCTGCGGGGGGCTCTTCCGCCATCAGACCCGGGTCTGCAG
GTTGCCCGCGAGCTCATCGTTGAGGACGAGATGGAATACGAAAAAAGAGCCGTCGATCTTGCCGGACGGCTTGCG
TATGTTGAAGTGACGGGGGCAGGTTATAGAGAAGGCCAAGGCAGACTCGCAGATATGCGTAAGATACTGTGGGAG
AACAAGTGGCAGTGTGCACTCTTCGATACTCGACGATGGGTCGACGAGGTCGAATGTGCCTACGAAGAAGCTTGG
CGGCGATGGGTCAATGGTGTTGGGGGAGACATATATCTCTGA
Transcript >Ophun1|6592
ATGGCCTACTACCACTATGGCTTGCGACTCGATCCCAATCATGTCCATCTGCACACAAACCTTGGCAGCCTCTTG
AAGGACATGGGTCAGCTGGACCGTGCCATCCAGATGTACGAGCGCGCCGTATTGTGTGACGGAACGTTTGACATC
GCTCTGACGAACCTCGCCAACGCCGTCAAGGACAAGGGTCGCATCGTCGACGCTATCGCATATTACCGTCGGGCT
GTGTATTCTAATCCGGAATTCGACGAGGCCGTGTGTGGCCTCTTCTTAGCATTGAATTCTGTGTGCAATTGGCGA
GGCCGTGGAGGTGTGCTACTGACTCCGGGCGGCTACGATAGATGGCACGTTGATGATGAAGGCAAAATCCTCGAT
GCTCGGATACAAGGCGGTGCCCGGGGCTTAGCCAAGCGAGTCGTGGACATTGTTACTCATCAGCTTCGAGATGCA
TCTGTTTGGGGCCAACATACTCTTCAAGAGCCAGTCATCCAAGTCATTGAACAGCAGCTTCGGCACCTCTGCGAA
GACTCATCCTTCCAGCTCGCCCCTGCTATCCGGCGATGGGCAGGCAAGCCATGGGAAGGTTCGCGATTGACCCGT
CTGTTGGAGAGAGCTGCTCGAGTGGCTCTCCGCAAGTGGTATTTGGATATCAACTATCGTGGCAAGGAGCTTTCG
GCTTCCGCTATTGTTCGGATACACATCCTGGTGAATCTCAATGGCTACACCAGAGGTGCTCGAAACGAAATCTTT
GCTGCCAGACCAGCACCAATACAGATGTCTTTCATGGGCTTCGCGGGGAGTCTGGGTGCCGAGTGGTGCGACTAT
ATACTGGCTGATAAAACGACCGTGCCTCCTGAAACCTTACGCCCATGGCGTAGGAACGTCAGCATTGAAGACGTT
CTCAAGGATGATAACGAATGCTGCGAGGGCCAGTGGGCGTACTCCGAGAATGTCATCTTTTGCCGCAGCACATTT
TTCTGCTGCGATCACGCTCAGTCGAGTGGACGGGGTGAGAAGACCTTGCCGTGGGATAGAGAGAAGCGAAGAAGA
TGGGAAATGCGCCGACAATTGTTCCCGGGTATGCCTGACGATACCGTCATTTTGGGTAACTTTAATCAATTGTAC
AAGATCGATCCAACGATATTCCGGTCATGGCTTCGAATCCTGTCCCGCGTTCCCAATGCCATACTCTGGCTTCTG
CGATTTCCCGAGCCAGGCGAGATGAACCTGCGGGCAACGGCTGAAACGTGGGCTGGGCCTGAGGTGGCAAAGCGC
CTTATCTTCACCGATGTGGCACCCAAGGATCAGCACATACTGCGTGCTCGCGTATGCGATCTGTTCCTCGACACT
CCCGAATGTAACGCACATACAACGGCCGCGGATGTCTTGTGGTCAAGCACGCCGCTACTGACTTTCCCACGTTAC
TCTTACAAAATGTGCTCTCGCATTGCCGCCTCAATTCTGCGGGGGGCTCTTCCGCCATCAGACCCGGGTCTGCAG
GTTGCCCGCGAGCTCATCGTTGAGGACGAGATGGAATACGAAAAAAGAGCCGTCGATCTTGCCGGACGGCTTGCG
TATGTTGAAGTGACGGGGGCAGGTTATAGAGAAGGCCAAGGCAGACTCGCAGATATGCGTAAGATACTGTGGGAG
AACAAGTGGCAGTGTGCACTCTTCGATACTCGACGATGGGTCGACGAGGTCGAATGTGCCTACGAAGAAGCTTGG
CGGCGATGGGTCAATGGTGTTGGGGGAGACATATATCTCTGA
Gene >Ophun1|6592
ATGGCCTACTACCACTATGGCTTGCGACTCGATCCCAATCATGTCCATCTGCACACAAACCTTGGCAGCCTCTTG
AAGGACATGGGTCAGCTGGACCGTGCCATCCAGATGTACGAGCGCGCCGTATTGTGTGACGGAACGTTTGACATC
GCTCTGACGAACCTCGCCAACGCCGTCAAGGACAAGGGTCGCATCGTCGACGCTATCGCATATTACCGTCGGGCT
GTGTATTCTAATCCGGAATTCGACGAGGCCGTGTGTGGCCTCTTCTTAGCATTGAATTCTGTGTGCAATTGGCGA
GGCCGTGGAGGTGTGCTACTGACTCCGGGCGGCTACGATAGATGGCACGTTGATGATGAAGGCAAAATCCTCGAT
GCTCGGATACAAGGCGGTGCCCGGGGCTTAGCCAAGCGAGTCGTGGACATTGTTACTCATCAGCTTCGAGATGCA
TCTGTTTGGGGCCAACATACTCTTCAAGAGCCAGTCATCCAAGTCATTGAACAGCAGCTTCGGCACCTCTGCGAA
GACTCATCCTTCCAGCTCGCCCCTGCTATCCGGCGATGGGCAGGCAAGCCATGGGAAGGTTCGCGATTGACCCGT
CTGTTGGAGAGAGCTGCTCGAGTGGCTCTCCGCAAGTGGTATTTGGATATCAACTATCGTGGCAAGGAGCTTTCG
GCTTCCGCTATTGTTCGGGTGAGGCTTCCGCCCGGCCTTGCGGTTCCGACGGCACCGACAGTGCTTCCATTCCAC
ACCTTCACATGCCCACTCGAGGCAAGCCAAATACGAGGAATAGCCCAAAGCAATGCGCTGCGAATTTCCTGCTCA
ACACTACGATCGTCATGGCTCCCTGCCACCCTCTTTCCGCCGCCTCCACCGCCCAGGCCGCAATTGAACGTTGGT
TATCTGTCGTCGGATTTCAATAACCACCCATTGGCTCATCTGTAAACGCCTTTTTTGCCTGGACTCGTAACGAAA
CTGACCAGGTTGATCAGAATGAAGTCTGTCTTTGGTTTTCACAATCCACGCCGTGTACGGTCTTTCTGCTATGCT
ACGACGACAAGCGACAGATCCATTCATAGACGACAGATTGAAAGAGAGGCTTCGGCTTTTCGCGATGTCAGCGGA
TTGTCGCCCGAGAAAGTGCTAGAGCAAATTGGCCGTGACCAGATACACATCCTGGTGAATCTCAATGGCTACACC
AGAGGTGCTCGAAACGAAATCTTTGCTGCCAGACCAGCACCAATACAGATGTCTTTCATGGGCTTCGCGGGGAGT
CTGGGTGCCGAGTGGTGCGACTATATACTGGCTGATAAAACGACCGTGCCTCCTGAAACCTTACGCCCATGGCGT
AGGAACGTCAGCATTGAAGACGTTCTCAAGGATGATAACGAATGCTGCGAGGGCCAGTGGGCGTACTCCGAGAAT
GTCATCTTTTGCCGCAGCACATTTTTCTGCTGCGATCACGCTCAGTCGAGTGGACGGGGTGAGAAGACCTTGCCG
TGGGATAGAGAGAAGCGAAGAAGATGGGAAATGCGCCGACAATTGTTCCCGGGTATGCCTGACGATACCGTCATT
TTGGGTAACTTTAATCAATTGTACAAGGTGAGCATCGCCTTGGTCCACATGCATAGAAAGAGACCATCAGGACTA
ACGGGACGCGTCTCTTCCAATCAAGATCGATCCAACGATATTCCGGTCATGGCTTCGAATCCTGTCCCGCGTTCC
CAATGCCATACTCTGGCTTCTGCGATTTCCCGAGCCAGGCGAGATGAACCTGCGGGCAACGGCTGAAACGTGGGC
TGGGCCTGAGGTGGCAAAGCGCCTTATCTTCACCGATGTGGCACCCAAGGATCAGCACATACTGCGTGCTCGCGT
ATGCGATCTGTTCCTCGACACTCCCGAATGTAACGCACATACAACGGCCGCGGATGTCTTGTGGTCAAGCACGCC
GCTACTGACTTTCCCACGTTACTCTTACAAAATGTGCTCTCGCATTGCCGCCTCAATTCTGCGGGGGGCTCTTCC
GCCATCAGACCCGGGTCTGCAGGTTGCCCGCGAGCTCATCGTTGAGGACGAGATGGAATACGAAAAAAGAGCCGT
CGATCTTGCCGGACGGCTTGCGTATGTTGAAGTGACGGGGGCAGGTTATAGAGAAGGCCAAGGCAGACTCGCAGA
TATGCGTAAGATACTGTGGGAGAACAAGTGGCAGTGTGCACTCTTCGATACTCGACGATGGGTCGACGAGGTCGA
ATGTGCCTACGAAGAAGCTTGGCGGCGATGGGTCAATGGTGTTGGGGGAGACATATATCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail