Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6584
Gene name
LocationContig_73:10369..10987
Strand-
Gene length (bp)618
Transcript length (bp)447
Coding sequence length (bp)447
Protein length (aa) 149

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01124 MAPEG MAPEG family 1.0E-21 13 139

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9CPU4|MGST3_MOUSE Microsomal glutathione S-transferase 3 OS=Mus musculus GN=Mgst3 PE=1 SV=1 21 125 2.0E-13
sp|Q3T100|MGST3_BOVIN Microsomal glutathione S-transferase 3 OS=Bos taurus GN=MGST3 PE=2 SV=1 11 124 3.0E-13
sp|O14880|MGST3_HUMAN Microsomal glutathione S-transferase 3 OS=Homo sapiens GN=MGST3 PE=1 SV=1 11 125 9.0E-13

GO

GO Term Description Terminal node
GO:0016021 integral component of membrane Yes
GO:0110165 cellular anatomical entity No
GO:0031224 intrinsic component of membrane No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6584
MAIPLELPDHLVLAAATSTFFVNTMHAFRTMKFRKASGVEYPQSYATNEQAAKNPSAYRFNCAQRAHHNFTENHT
SLLGALLIAGIRYPVPAAALGAGWSLSRILYLLGYTSSAGPRGRLAGAIGGNLSDLFLKLAAAYSSAMFILGK*
Coding >Ophun1|6584
ATGGCGATTCCTCTTGAACTCCCTGATCACCTGGTGCTCGCGGCCGCCACGAGTACTTTCTTCGTCAACACCATG
CACGCCTTCCGCACCATGAAGTTCCGCAAGGCCAGCGGAGTCGAATATCCCCAAAGCTACGCAACCAACGAACAG
GCGGCCAAGAATCCGTCCGCCTACCGATTCAACTGCGCTCAACGAGCTCACCACAACTTCACCGAGAATCACACA
TCTCTTCTCGGCGCTTTGCTCATCGCTGGTATTCGCTATCCTGTTCCCGCGGCCGCTCTCGGGGCTGGATGGAGC
TTGTCGAGGATCTTGTACCTGCTCGGCTATACCAGCTCTGCCGGCCCTCGCGGCCGATTGGCCGGTGCCATCGGC
GGCAATCTAAGCGACTTGTTCCTCAAACTAGCTGCGGCCTACTCATCTGCCATGTTCATCCTTGGCAAATAG
Transcript >Ophun1|6584
ATGGCGATTCCTCTTGAACTCCCTGATCACCTGGTGCTCGCGGCCGCCACGAGTACTTTCTTCGTCAACACCATG
CACGCCTTCCGCACCATGAAGTTCCGCAAGGCCAGCGGAGTCGAATATCCCCAAAGCTACGCAACCAACGAACAG
GCGGCCAAGAATCCGTCCGCCTACCGATTCAACTGCGCTCAACGAGCTCACCACAACTTCACCGAGAATCACACA
TCTCTTCTCGGCGCTTTGCTCATCGCTGGTATTCGCTATCCTGTTCCCGCGGCCGCTCTCGGGGCTGGATGGAGC
TTGTCGAGGATCTTGTACCTGCTCGGCTATACCAGCTCTGCCGGCCCTCGCGGCCGATTGGCCGGTGCCATCGGC
GGCAATCTAAGCGACTTGTTCCTCAAACTAGCTGCGGCCTACTCATCTGCCATGTTCATCCTTGGCAAATAG
Gene >Ophun1|6584
ATGGCGATTCCTCTTGAACTCCCTGATCAGTATGGGTCAGTGAGAGAGCCCTTGAACCTCGTTCGCGAGCGCTGG
CTAACAGCTGCGTGTTCTTCAGCCTGGTGCTCGCGGCCGCCACGAGTACTTTCTTCGTCAACACCATGCACGCCT
TCCGCACCATGAAGTTCCGCAAGGCCAGCGGAGTCGAATATCCCCAAAGCTACGCAACCAACGAACAGGCGGCCA
AGAATCCGTCCGCCTACCGATTCAACTGCGGTCCGTTGCCCGTCTCGTCCTCCAGCCGTACGTCACTGACACTTC
AACAGCTCAACGAGCTCACCACAACTTCACCGAGAATCACACATCTCTTCTCGGCGCTTTGCTCATCGCTGGTAT
TCGCTATCCTGTTCCCGCGGCCGCTCTCGGGGCTGGATGGAGCTTGTCGAGGATCTTGTACCTGCTCGGCTATAC
CAGCTCTGCCGGCCCTCGCGGCCGATTGGCGTATGTCATTCTCGGTGCTTGTCATCAGCCGAATCGGACTAATGC
GTCTTCAGCGGTGCCATCGGCGGCAATCTAAGCGACTTGTTCCTCAAACTAGCTGCGGCCTACTCATCTGCCATG
TTCATCCTTGGCAAATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail