Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6579
Gene name
LocationContig_73:1761..3291
Strand+
Gene length (bp)1530
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10998 DUF2838 Protein of unknown function (DUF2838) 2.3E-43 165 275

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|O94673|YG75_SCHPO Uncharacterized membrane protein C776.05 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC776.05 PE=4 SV=2 88 453 2.0E-108
sp|P48236|YG3L_YEAST Uncharacterized membrane protein YGR149W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YGR149W PE=1 SV=1 117 455 1.0E-68

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

Domain # Start End Length
1 167 186 19
2 190 209 19
3 216 238 22
4 242 261 19
5 273 295 22
6 322 344 22
7 415 437 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6579
MTSNKQAKEPDAGSDHEADADLDVPTLSADDAVSPESPILEATDEGGRRLSRNPSYSEGSSHNDDWNSLPPLDRL
TIFDFLDNLALPQQLEKLQKGITAQKEKVKRSRDAFKSTTQQARHRMVEEWRRRVPSADEQLERYKKRMRRRVDK
LGQQWSDTKVIGIRDKISFICGVMNIFISGYLIGAFPQYFHLWYTAQLVYFLPLRFWTYHRQGYHYFVADLCYFV
NVLLTLSIWAFPSSKRLFTATYGLAFGNNAASIVMWRNSLVFHSLDKVTSLFIHIMPCVTLHCLVHLMPLEQQEQ
RFPAIWTIKNSDPGSPTAYANVASMLAWSTFPYAVWQLSYYFLITVRRRDKIAAGRPTSFTWLRRSYSNTWIGKL
VLSLPDRLQEPTYMMIQYSYAVLTMLPCPLWFKNQHASSAFLLVLFAWSVYNGSTYYIDVFGKRFQKELEAMKAE
VSKWQSASDLAVQSPMLSPRPDDAPAQTSTRKDAHSTGATTQDKEDVVRRPTSRKQYFD*
Coding >Ophun1|6579
ATGACGTCCAACAAGCAGGCAAAAGAACCCGACGCCGGCTCCGATCACGAGGCCGATGCGGACCTCGACGTCCCT
ACTTTGTCCGCCGACGACGCCGTTTCGCCCGAGTCGCCCATCCTCGAGGCCACCGATGAGGGCGGACGGAGGCTA
TCGCGGAACCCGTCGTACTCGGAGGGCAGCTCGCATAATGACGACTGGAACTCCCTGCCTCCTCTCGACAGACTC
ACCATCTTCGACTTTCTCGATAATCTCGCCCTGCCGCAACAGCTCGAAAAACTCCAAAAGGGCATCACGGCGCAA
AAGGAAAAGGTCAAGCGGTCTAGGGATGCCTTCAAGTCCACAACGCAGCAGGCGCGCCATCGCATGGTGGAGGAG
TGGCGTCGTCGCGTCCCATCAGCCGACGAACAGCTCGAGCGCTACAAGAAGCGCATGCGCCGCCGCGTCGATAAG
CTCGGACAGCAGTGGAGCGACACAAAGGTCATTGGCATACGCGACAAGATATCCTTTATATGCGGCGTCATGAAC
ATCTTCATCAGCGGTTACCTCATCGGCGCCTTTCCGCAGTACTTTCATCTCTGGTACACGGCTCAACTCGTTTAT
TTCTTGCCTCTCCGTTTCTGGACATATCACCGCCAAGGCTATCACTACTTTGTCGCCGATTTGTGCTACTTCGTC
AACGTCTTGCTCACCCTCAGCATATGGGCGTTCCCCTCTTCCAAGCGCCTGTTTACCGCTACCTACGGCCTCGCG
TTTGGCAACAATGCTGCCTCAATCGTCATGTGGCGGAACTCGCTTGTCTTTCATAGCCTAGACAAGGTCACATCG
CTCTTCATCCACATCATGCCTTGTGTCACGCTCCATTGTCTCGTCCATTTGATGCCGTTGGAACAGCAAGAGCAG
AGGTTTCCCGCAATCTGGACTATCAAAAACTCGGACCCGGGCTCACCGACGGCCTATGCTAATGTCGCGTCTATG
CTGGCATGGAGCACATTTCCATACGCCGTCTGGCAGCTGAGTTACTACTTTCTCATTACGGTGCGCAGACGAGAC
AAGATTGCCGCAGGCCGGCCCACGTCTTTTACCTGGCTACGACGATCATACTCGAATACTTGGATAGGCAAGTTG
GTCTTGTCTCTCCCAGACAGGCTTCAAGAGCCGACCTACATGATGATCCAGTACAGCTATGCTGTGTTGACCATG
CTACCATGTCCCCTGTGGTTCAAAAACCAGCACGCCTCTTCGGCTTTCCTCCTCGTCCTCTTCGCCTGGAGCGTC
TACAACGGCTCAACCTATTACATCGATGTCTTCGGCAAGCGATTCCAAAAGGAGCTCGAAGCCATGAAGGCCGAG
GTCTCGAAATGGCAAAGCGCATCAGATCTGGCCGTTCAATCCCCAATGTTGAGCCCACGCCCAGATGACGCCCCC
GCGCAAACGTCCACCCGCAAGGATGCGCACTCTACAGGCGCCACCACTCAAGACAAAGAGGATGTCGTTCGACGC
CCGACAAGCCGCAAGCAATACTTTGACTGA
Transcript >Ophun1|6579
ATGACGTCCAACAAGCAGGCAAAAGAACCCGACGCCGGCTCCGATCACGAGGCCGATGCGGACCTCGACGTCCCT
ACTTTGTCCGCCGACGACGCCGTTTCGCCCGAGTCGCCCATCCTCGAGGCCACCGATGAGGGCGGACGGAGGCTA
TCGCGGAACCCGTCGTACTCGGAGGGCAGCTCGCATAATGACGACTGGAACTCCCTGCCTCCTCTCGACAGACTC
ACCATCTTCGACTTTCTCGATAATCTCGCCCTGCCGCAACAGCTCGAAAAACTCCAAAAGGGCATCACGGCGCAA
AAGGAAAAGGTCAAGCGGTCTAGGGATGCCTTCAAGTCCACAACGCAGCAGGCGCGCCATCGCATGGTGGAGGAG
TGGCGTCGTCGCGTCCCATCAGCCGACGAACAGCTCGAGCGCTACAAGAAGCGCATGCGCCGCCGCGTCGATAAG
CTCGGACAGCAGTGGAGCGACACAAAGGTCATTGGCATACGCGACAAGATATCCTTTATATGCGGCGTCATGAAC
ATCTTCATCAGCGGTTACCTCATCGGCGCCTTTCCGCAGTACTTTCATCTCTGGTACACGGCTCAACTCGTTTAT
TTCTTGCCTCTCCGTTTCTGGACATATCACCGCCAAGGCTATCACTACTTTGTCGCCGATTTGTGCTACTTCGTC
AACGTCTTGCTCACCCTCAGCATATGGGCGTTCCCCTCTTCCAAGCGCCTGTTTACCGCTACCTACGGCCTCGCG
TTTGGCAACAATGCTGCCTCAATCGTCATGTGGCGGAACTCGCTTGTCTTTCATAGCCTAGACAAGGTCACATCG
CTCTTCATCCACATCATGCCTTGTGTCACGCTCCATTGTCTCGTCCATTTGATGCCGTTGGAACAGCAAGAGCAG
AGGTTTCCCGCAATCTGGACTATCAAAAACTCGGACCCGGGCTCACCGACGGCCTATGCTAATGTCGCGTCTATG
CTGGCATGGAGCACATTTCCATACGCCGTCTGGCAGCTGAGTTACTACTTTCTCATTACGGTGCGCAGACGAGAC
AAGATTGCCGCAGGCCGGCCCACGTCTTTTACCTGGCTACGACGATCATACTCGAATACTTGGATAGGCAAGTTG
GTCTTGTCTCTCCCAGACAGGCTTCAAGAGCCGACCTACATGATGATCCAGTACAGCTATGCTGTGTTGACCATG
CTACCATGTCCCCTGTGGTTCAAAAACCAGCACGCCTCTTCGGCTTTCCTCCTCGTCCTCTTCGCCTGGAGCGTC
TACAACGGCTCAACCTATTACATCGATGTCTTCGGCAAGCGATTCCAAAAGGAGCTCGAAGCCATGAAGGCCGAG
GTCTCGAAATGGCAAAGCGCATCAGATCTGGCCGTTCAATCCCCAATGTTGAGCCCACGCCCAGATGACGCCCCC
GCGCAAACGTCCACCCGCAAGGATGCGCACTCTACAGGCGCCACCACTCAAGACAAAGAGGATGTCGTTCGACGC
CCGACAAGCCGCAAGCAATACTTTGACTGA
Gene >Ophun1|6579
ATGACGTCCAACAAGCAGGCAAAAGAACCCGACGCCGGCTCCGATCACGAGGCCGATGCGGACCTCGACGTCCCT
ACTTTGTCCGCCGACGACGCCGTTTCGCCCGAGTCGCCCATCCTCGAGGCCACCGATGAGGGCGGACGGAGGCTA
TCGCGGAACCCGTCGTACTCGGAGGGCAGCTCGCATAATGACGACTGGAACTCCCTGCCTCCTCTCGACAGACTC
ACCATCTTCGACTTTCTCGATAATCTCGCCCTGCCGCAACAGCTCGAAAAACTCCAAAAGGGCATCACGGCGCAA
AAGGAAAAGGTCAAGCGGTCTAGGGATGCCTTCAAGTCCACAACGCAGCAGGCGCGCCATCGCATGGTGGAGGAG
TGGCGTCGTCGCGTCCCATCAGCCGACGAACAGCTCGAGCGCTACAAGAAGCGCATGCGCCGCCGCGTCGATAAG
CTCGGACAGCAGTGGAGCGACACAAAGGTCATTGGCATACGCGACAAGATATCCTTTATATGCGGCGTCATGAAC
ATCTTCATCAGCGGTTACCTCATCGGCGCCTTTCCGCAGTACTTTCATCTCTGGTACACGGCTCAACTCGTTTAT
TTCTTGCCTCTCCGTTTCTGGACATATCACCGCCAAGGCTATCACTACTTTGTCGCCGATTTGTGCTACTTCGTC
AACGTCTTGCTCACCCTCAGCATATGGGCGTTCCCCTCTTCCAAGCGCCTGTTTACCGCTACCTACGGCCTCGCG
TTTGGCAACAATGCTGCCTCAATCGTCATGTGGCGGAACTCGCTTGTCTTTCATAGCCTAGACAAGGTCACATCG
CTCTTCATCCACATCATGCCTTGTGTCACGCTCCATTGTCTCGTCCATTTGATGCCGTTGGAACAGCAAGAGCAG
AGGTTTCCCGCAATCTGGACTATCAAAAACTCGGACCCGGGCTCACCGACGGCCTATGCTAATGTCGCGTCTATG
CTGGCATGGAGCACATTTCCATACGCCGTCTGGCAGCTGAGTTACTACTTTCTCATTACGGTGCGCAGACGAGAC
AAGATTGCCGCAGGCCGGCCCACGTCTTTTACCTGGCTACGACGATCATACTCGAATACTTGGATAGGCAAGTTG
GTCTTGTCTCTCCCAGACAGGCTTCAAGAGCCGACCTACATGATGATCCAGTACAGCTATGCTGTGTTGACCATG
CTACCATGTCCCCTGTGGTTCAAAAACCAGCACGCCTCTTCGGCTTTCCTCCTCGTCCTCTTCGCCTGGAGCGTC
TACAACGGCTCAACCTATTACATCGATGTCTTCGGCAAGCGATTCCAAAAGGAGCTCGAAGCCATGAAGGCCGAG
GTCTCGAAATGGCAAAGCGCATCAGATCTGGCCGTTCAATCCCCAATGTTGAGCCCACGCCCAGATGACGCCCCC
GCGCAAACGTCCACCCGCAAGGATGCGCACTCTACAGGCGCCACCACTCAAGACAAAGAGGATGTCGTTCGACGC
CCGACAAGCCGCAAGCAATACTTTGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail