Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6578
Gene name
LocationContig_729:7301..8177
Strand-
Gene length (bp)876
Transcript length (bp)876
Coding sequence length (bp)876
Protein length (aa) 292

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00505 HMG_box HMG (high mobility group) box 5.2E-07 69 138

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q03973|HMO1_YEAST High mobility group protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HMO1 PE=1 SV=1 39 130 2.0E-07

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
HMG

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2836
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2478
Ophiocordyceps australis map64 (Brazil) OphauB2|9
Ophiocordyceps camponoti-floridani Ophcf2|02327
Ophiocordyceps camponoti-rufipedis Ophun1|6578 (this protein)
Ophiocordyceps kimflemingae Ophio5|4336
Ophiocordyceps subramaniannii Hirsu2|4631

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6578
MELLRSFTADYVRQTNLLMGEPTAEPNQGDLLSSFENAAAQLIMPVPEMAAPVEEKKERKKRTHDPNAPKRPLTP
YFLYMQHARSIIASDLGDDSPKGAVQEEGQRRWANMAPHEKKGWNAAYQYNLRLYNARVHSYKAGNPLAKNMNDD
EALKYANEFGIPMPEVKDVPAETPVNDQDAVAEQIQQLQDHHHHQPQPQLLPPHLQQQQQPQPQPQQHAMPVESS
DAKTPKKSGGGRKRKGASPVADLIPSEPVKGTPASPDKKRRRASAKTGDDKDESKKSGRKRAKGSS*
Coding >Ophun1|6578
ATGGAGCTCCTGCGCTCTTTCACGGCAGACTATGTCCGCCAGACCAACCTGCTCATGGGCGAGCCCACCGCTGAG
CCCAATCAGGGCGACCTGCTGAGCTCCTTTGAGAACGCGGCCGCGCAGCTCATCATGCCCGTGCCCGAAATGGCG
GCTCCCGTCGAGGAGAAAAAGGAGCGCAAGAAGCGGACGCACGATCCCAATGCTCCCAAGCGTCCCCTGACGCCT
TATTTCCTCTACATGCAGCACGCTCGCTCCATCATCGCCAGCGACCTCGGCGACGACTCCCCCAAGGGCGCCGTC
CAGGAGGAGGGCCAGCGCCGCTGGGCCAACATGGCTCCTCATGAGAAGAAGGGCTGGAACGCGGCCTACCAGTAC
AATCTGCGCCTCTACAACGCCCGCGTTCACTCGTACAAGGCCGGCAACCCGCTGGCCAAGAACATGAACGACGAC
GAGGCCCTCAAGTACGCAAACGAGTTCGGAATCCCCATGCCCGAAGTCAAGGACGTCCCCGCCGAGACGCCCGTC
AACGACCAGGACGCCGTGGCCGAGCAGATCCAGCAACTCCAGGACCATCATCACCATCAGCCGCAGCCCCAGCTG
CTGCCGCCTCACCTGCAACAACAACAGCAGCCCCAGCCTCAGCCCCAGCAGCACGCCATGCCCGTCGAATCCTCC
GACGCCAAGACGCCCAAGAAGTCCGGCGGCGGCCGCAAGCGCAAGGGAGCCTCTCCGGTCGCCGACCTCATCCCG
TCCGAACCCGTCAAGGGCACGCCCGCCAGCCCGGACAAGAAGCGCCGCCGCGCGTCGGCCAAGACGGGCGACGAC
AAGGACGAGTCCAAGAAGTCGGGTCGCAAGAGGGCTAAGGGCTCCTCTTAG
Transcript >Ophun1|6578
ATGGAGCTCCTGCGCTCTTTCACGGCAGACTATGTCCGCCAGACCAACCTGCTCATGGGCGAGCCCACCGCTGAG
CCCAATCAGGGCGACCTGCTGAGCTCCTTTGAGAACGCGGCCGCGCAGCTCATCATGCCCGTGCCCGAAATGGCG
GCTCCCGTCGAGGAGAAAAAGGAGCGCAAGAAGCGGACGCACGATCCCAATGCTCCCAAGCGTCCCCTGACGCCT
TATTTCCTCTACATGCAGCACGCTCGCTCCATCATCGCCAGCGACCTCGGCGACGACTCCCCCAAGGGCGCCGTC
CAGGAGGAGGGCCAGCGCCGCTGGGCCAACATGGCTCCTCATGAGAAGAAGGGCTGGAACGCGGCCTACCAGTAC
AATCTGCGCCTCTACAACGCCCGCGTTCACTCGTACAAGGCCGGCAACCCGCTGGCCAAGAACATGAACGACGAC
GAGGCCCTCAAGTACGCAAACGAGTTCGGAATCCCCATGCCCGAAGTCAAGGACGTCCCCGCCGAGACGCCCGTC
AACGACCAGGACGCCGTGGCCGAGCAGATCCAGCAACTCCAGGACCATCATCACCATCAGCCGCAGCCCCAGCTG
CTGCCGCCTCACCTGCAACAACAACAGCAGCCCCAGCCTCAGCCCCAGCAGCACGCCATGCCCGTCGAATCCTCC
GACGCCAAGACGCCCAAGAAGTCCGGCGGCGGCCGCAAGCGCAAGGGAGCCTCTCCGGTCGCCGACCTCATCCCG
TCCGAACCCGTCAAGGGCACGCCCGCCAGCCCGGACAAGAAGCGCCGCCGCGCGTCGGCCAAGACGGGCGACGAC
AAGGACGAGTCCAAGAAGTCGGGTCGCAAGAGGGCTAAGGGCTCCTCTTAG
Gene >Ophun1|6578
ATGGAGCTCCTGCGCTCTTTCACGGCAGACTATGTCCGCCAGACCAACCTGCTCATGGGCGAGCCCACCGCTGAG
CCCAATCAGGGCGACCTGCTGAGCTCCTTTGAGAACGCGGCCGCGCAGCTCATCATGCCCGTGCCCGAAATGGCG
GCTCCCGTCGAGGAGAAAAAGGAGCGCAAGAAGCGGACGCACGATCCCAATGCTCCCAAGCGTCCCCTGACGCCT
TATTTCCTCTACATGCAGCACGCTCGCTCCATCATCGCCAGCGACCTCGGCGACGACTCCCCCAAGGGCGCCGTC
CAGGAGGAGGGCCAGCGCCGCTGGGCCAACATGGCTCCTCATGAGAAGAAGGGCTGGAACGCGGCCTACCAGTAC
AATCTGCGCCTCTACAACGCCCGCGTTCACTCGTACAAGGCCGGCAACCCGCTGGCCAAGAACATGAACGACGAC
GAGGCCCTCAAGTACGCAAACGAGTTCGGAATCCCCATGCCCGAAGTCAAGGACGTCCCCGCCGAGACGCCCGTC
AACGACCAGGACGCCGTGGCCGAGCAGATCCAGCAACTCCAGGACCATCATCACCATCAGCCGCAGCCCCAGCTG
CTGCCGCCTCACCTGCAACAACAACAGCAGCCCCAGCCTCAGCCCCAGCAGCACGCCATGCCCGTCGAATCCTCC
GACGCCAAGACGCCCAAGAAGTCCGGCGGCGGCCGCAAGCGCAAGGGAGCCTCTCCGGTCGCCGACCTCATCCCG
TCCGAACCCGTCAAGGGCACGCCCGCCAGCCCGGACAAGAAGCGCCGCCGCGCGTCGGCCAAGACGGGCGACGAC
AAGGACGAGTCCAAGAAGTCGGGTCGCAAGAGGGCTAAGGGCTCCTCTTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail