Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6571
Gene name
LocationContig_728:3184..3975
Strand+
Gene length (bp)791
Transcript length (bp)702
Coding sequence length (bp)702
Protein length (aa) 234

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05773 RWD RWD domain 2.1E-20 4 114
PF16543 DFRP_C DRG Family Regulatory Proteins, Tma46 4.1E-07 132 218

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O94721|YCF9_SCHPO RWD domain-containing protein C1393.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.09c PE=3 SV=1 8 204 1.0E-25
sp|Q03768|GIR2_YEAST Protein GIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIR2 PE=1 SV=1 4 230 7.0E-22
sp|Q9H446|RWDD1_HUMAN RWD domain-containing protein 1 OS=Homo sapiens GN=RWDD1 PE=1 SV=1 4 200 2.0E-19
sp|Q99ND9|RWDD1_RAT RWD domain-containing protein 1 OS=Rattus norvegicus GN=Rwdd1 PE=2 SV=1 4 200 6.0E-19
sp|Q9CQK7|RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus GN=Rwdd1 PE=1 SV=1 4 200 1.0E-18
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O94721|YCF9_SCHPO RWD domain-containing protein C1393.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1393.09c PE=3 SV=1 8 204 1.0E-25
sp|Q03768|GIR2_YEAST Protein GIR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=GIR2 PE=1 SV=1 4 230 7.0E-22
sp|Q9H446|RWDD1_HUMAN RWD domain-containing protein 1 OS=Homo sapiens GN=RWDD1 PE=1 SV=1 4 200 2.0E-19
sp|Q99ND9|RWDD1_RAT RWD domain-containing protein 1 OS=Rattus norvegicus GN=Rwdd1 PE=2 SV=1 4 200 6.0E-19
sp|Q9CQK7|RWDD1_MOUSE RWD domain-containing protein 1 OS=Mus musculus GN=Rwdd1 PE=1 SV=1 4 200 1.0E-18
sp|Q9CPR1|RWDD4_MOUSE RWD domain-containing protein 4 OS=Mus musculus GN=Rwdd4 PE=2 SV=1 3 121 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1930
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|2812
Ophiocordyceps australis map64 (Brazil) OphauB2|7777
Ophiocordyceps camponoti-floridani Ophcf2|07356
Ophiocordyceps camponoti-rufipedis Ophun1|6571 (this protein)
Ophiocordyceps kimflemingae Ophio5|6656
Ophiocordyceps subramaniannii Hirsu2|2063

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6571
MPHEEQVEERQVLESIFPDEITDISETEFRISVTLDTDASPPPPRLLLHVRYPEAYPDVAPHLDLLAHPDDDSRH
AYLSVADDRDQLLAELEAAVQENLGIAMVFTLVSALRDAAEALVQKRIDDEANVRHEALLAAEREENSKFHGTPV
TPESFRDWRQAFRAEMEEQSRRDEEDRLAELKRAKIKEPVKLLTGRQLWERGLAGKGEDEDEDDDADAAVPTKGL
EKLQVDPS*
Coding >Ophun1|6571
ATGCCTCACGAGGAGCAGGTCGAGGAGCGTCAAGTCCTCGAGTCCATCTTCCCCGACGAAATCACCGACATCTCC
GAGACCGAATTCCGCATCAGCGTCACCCTCGACACCGACGCCTCCCCTCCTCCCCCCCGCCTCCTCCTCCACGTC
CGATACCCAGAAGCCTACCCAGACGTGGCCCCCCATCTCGACCTCCTCGCCCATCCCGACGATGACTCGCGCCAC
GCCTACCTCAGCGTCGCCGACGACCGCGACCAGCTCCTCGCAGAGTTGGAAGCCGCCGTACAGGAGAACCTCGGC
ATCGCAATGGTCTTCACCCTCGTTTCCGCCCTGCGCGACGCCGCAGAGGCCCTCGTCCAGAAACGCATCGACGAC
GAGGCCAATGTCCGTCACGAAGCTCTCCTCGCCGCCGAGCGTGAGGAGAACAGCAAGTTTCACGGCACGCCCGTC
ACGCCTGAATCCTTCCGCGATTGGCGTCAAGCCTTTCGCGCCGAGATGGAGGAGCAGAGTCGCAGAGACGAGGAG
GATCGTCTTGCTGAGCTCAAGAGGGCCAAGATTAAGGAGCCGGTTAAGCTCCTCACCGGCAGGCAGCTCTGGGAG
CGCGGCCTCGCCGGCAAGGGCGAAGACGAAGACGAAGACGACGATGCTGACGCTGCCGTTCCGACCAAGGGCCTG
GAGAAGCTGCAGGTCGATCCGTCGTGA
Transcript >Ophun1|6571
ATGCCTCACGAGGAGCAGGTCGAGGAGCGTCAAGTCCTCGAGTCCATCTTCCCCGACGAAATCACCGACATCTCC
GAGACCGAATTCCGCATCAGCGTCACCCTCGACACCGACGCCTCCCCTCCTCCCCCCCGCCTCCTCCTCCACGTC
CGATACCCAGAAGCCTACCCAGACGTGGCCCCCCATCTCGACCTCCTCGCCCATCCCGACGATGACTCGCGCCAC
GCCTACCTCAGCGTCGCCGACGACCGCGACCAGCTCCTCGCAGAGTTGGAAGCCGCCGTACAGGAGAACCTCGGC
ATCGCAATGGTCTTCACCCTCGTTTCCGCCCTGCGCGACGCCGCAGAGGCCCTCGTCCAGAAACGCATCGACGAC
GAGGCCAATGTCCGTCACGAAGCTCTCCTCGCCGCCGAGCGTGAGGAGAACAGCAAGTTTCACGGCACGCCCGTC
ACGCCTGAATCCTTCCGCGATTGGCGTCAAGCCTTTCGCGCCGAGATGGAGGAGCAGAGTCGCAGAGACGAGGAG
GATCGTCTTGCTGAGCTCAAGAGGGCCAAGATTAAGGAGCCGGTTAAGCTCCTCACCGGCAGGCAGCTCTGGGAG
CGCGGCCTCGCCGGCAAGGGCGAAGACGAAGACGAAGACGACGATGCTGACGCTGCCGTTCCGACCAAGGGCCTG
GAGAAGCTGCAGGTCGATCCGTCGTGA
Gene >Ophun1|6571
ATGCCTCACGAGGAGCAGGTCGAGGAGCGTCAAGTCCTCGAGTCCATCTTCCCCGACGAAATCACCGGTATGGTT
CCATCCTTCCTACCCACTCTCCACCACTCCAACATAGCCAGCTCCAGCTTCACTCCTCCAATACTCTAACTCGCT
CTCTAGACATCTCCGAGACCGAATTCCGCATCAGCGTCACCCTCGACACCGACGCCTCCCCTCCTCCCCCCCGCC
TCCTCCTCCACGTCCGATACCCAGAAGCCTACCCAGACGTGGCCCCCCATCTCGACCTCCTCGCCCATCCCGACG
ATGACTCGCGCCACGCCTACCTCAGCGTCGCCGACGACCGCGACCAGCTCCTCGCAGAGTTGGAAGCCGCCGTAC
AGGAGAACCTCGGCATCGCAATGGTCTTCACCCTCGTTTCCGCCCTGCGCGACGCCGCAGAGGCCCTCGTCCAGA
AACGCATCGACGACGAGGCCAATGTCCGTCACGAAGCTCTCCTCGCCGCCGAGCGTGAGGAGAACAGCAAGTTTC
ACGGCACGCCCGTCACGCCTGAATCCTTCCGCGATTGGCGTCAAGCCTTTCGCGCCGAGATGGAGGAGCAGAGTC
GCAGAGACGAGGAGGATCGTCTTGCTGAGCTCAAGAGGGCCAAGATTAAGGAGCCGGTTAAGCTCCTCACCGGCA
GGCAGCTCTGGGAGCGCGGCCTCGCCGGCAAGGGCGAAGACGAAGACGAAGACGACGATGCTGACGCTGCCGTTC
CGACCAAGGGCCTGGAGAAGCTGCAGGTCGATCCGTCGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail