Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6567
Gene name
LocationContig_727:2360..5782
Strand+
Gene length (bp)3422
Transcript length (bp)2949
Coding sequence length (bp)2949
Protein length (aa) 983

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00491 Arginase Arginase family 9.1E-92 69 365
PF00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) 6.7E-87 659 975
PF01336 tRNA_anti-codon OB-fold nucleic acid binding domain 2.7E-07 555 635

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P38707|SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED81 PE=1 SV=1 413 982 0.0E+00
sp|Q6BU46|SYNC_DEBHA Asparagine--tRNA ligase, cytoplasmic OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED81 PE=3 SV=1 414 982 0.0E+00
sp|O94567|SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrs1 PE=3 SV=1 407 982 3.0E-177
sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=NARS PE=1 SV=1 414 982 5.0E-170
sp|Q8BP47|SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Nars PE=1 SV=2 414 982 1.0E-168
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P38707|SYNC_YEAST Asparagine--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DED81 PE=1 SV=1 413 982 0.0E+00
sp|Q6BU46|SYNC_DEBHA Asparagine--tRNA ligase, cytoplasmic OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=DED81 PE=3 SV=1 414 982 0.0E+00
sp|O94567|SYNC_SCHPO Probable asparagine--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=nrs1 PE=3 SV=1 407 982 3.0E-177
sp|O43776|SYNC_HUMAN Asparagine--tRNA ligase, cytoplasmic OS=Homo sapiens GN=NARS PE=1 SV=1 414 982 5.0E-170
sp|Q8BP47|SYNC_MOUSE Asparagine--tRNA ligase, cytoplasmic OS=Mus musculus GN=Nars PE=1 SV=2 414 982 1.0E-168
sp|Q2KJG3|SYNC_BOVIN Asparagine--tRNA ligase, cytoplasmic OS=Bos taurus GN=NARS PE=2 SV=3 414 982 4.0E-167
sp|Q4R4Z1|SYNC_MACFA Asparagine--tRNA ligase, cytoplasmic OS=Macaca fascicularis GN=NARS PE=2 SV=1 414 982 4.0E-166
sp|Q19722|SYNC_CAEEL Asparagine--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=nrs-1 PE=3 SV=1 414 982 3.0E-165
sp|P10723|SYNC_BRUMA Asparagine--tRNA ligase, cytoplasmic OS=Brugia malayi PE=1 SV=1 413 982 7.0E-151
sp|Q6CIB4|GBU1_KLULA Guanidinobutyrase OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=GBU1 PE=1 SV=1 34 384 1.0E-129
sp|O42887|SPEB2_SCHPO Putative agmatinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC8E4.03 PE=3 SV=1 8 372 2.0E-125
sp|Q554D9|SYNC_DICDI Asparagine--tRNA ligase, cytoplasmic OS=Dictyostelium discoideum GN=asnS1 PE=1 SV=1 495 982 4.0E-125
sp|Q10088|SPEB1_SCHPO Putative agmatinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC11D3.09 PE=3 SV=1 46 371 5.0E-94
sp|Q9C0Y9|SPEB3_SCHPO Putative agmatinase 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB24D3.03 PE=3 SV=2 35 371 2.0E-92
sp|C4V847|SYNC_NOSCE Probable asparagine--tRNA ligase, cytoplasmic OS=Nosema ceranae (strain BRL01) GN=NCER_100652 PE=3 SV=1 522 982 7.0E-87
sp|Q979Y4|SYN_THEVO Asparagine--tRNA ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=asnS PE=3 SV=1 541 982 2.0E-86
sp|Q8SQK8|SYNC_ENCCU Probable asparagine--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU09_1680 PE=3 SV=2 552 982 1.0E-85
sp|Q9HKS7|SYN_THEAC Asparagine--tRNA ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=asnS PE=3 SV=1 552 982 7.0E-85
sp|C5A4R8|SYN_THEGJ Asparagine--tRNA ligase OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=asnS PE=3 SV=1 550 982 2.0E-77
sp|Q9V251|SYN_PYRAB Asparagine--tRNA ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=asnS PE=3 SV=1 552 982 5.0E-76
sp|Q5JHC1|SYN_THEKO Asparagine--tRNA ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=asnS PE=3 SV=1 550 982 7.0E-76
sp|A9CTP8|SYNC_ENTBH Probable asparagine--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_22533 PE=3 SV=1 548 982 2.0E-75
sp|O57980|SYN_PYRHO Asparagine--tRNA ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=asnS PE=1 SV=1 552 982 2.0E-75
sp|Q8U4D3|SYN_PYRFU Asparagine--tRNA ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=asnS PE=3 SV=2 550 982 2.0E-74
sp|A4IQ54|SYN_GEOTN Asparagine--tRNA ligase OS=Geobacillus thermodenitrificans (strain NG80-2) GN=asnS PE=3 SV=1 552 982 4.0E-73
sp|Q9KC78|SYN_BACHD Asparagine--tRNA ligase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=asnS PE=3 SV=1 565 982 6.0E-73
sp|Q8EQE2|SYN_OCEIH Asparagine--tRNA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=asnS PE=3 SV=1 555 982 3.0E-71
sp|B2GA02|SYN_LACRJ Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain JCM 1112) GN=asnS PE=3 SV=1 540 982 7.0E-71
sp|A5VMP9|SYN_LACRD Asparagine--tRNA ligase OS=Lactobacillus reuteri (strain DSM 20016) GN=asnS PE=3 SV=1 540 982 7.0E-71
sp|Q65I63|SYN_BACLD Asparagine--tRNA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=asnS PE=3 SV=1 552 982 2.0E-70
sp|Q1IHQ3|SYN_KORVE Asparagine--tRNA ligase OS=Koribacter versatilis (strain Ellin345) GN=asnS PE=3 SV=1 552 982 6.0E-70
sp|Q5WGB1|SYN_BACSK Asparagine--tRNA ligase OS=Bacillus clausii (strain KSM-K16) GN=asnS PE=3 SV=1 554 982 1.0E-69
sp|A9GBR2|SYN_SORC5 Asparagine--tRNA ligase OS=Sorangium cellulosum (strain So ce56) GN=asnS PE=3 SV=1 541 982 1.0E-69
sp|Q67P26|SYN_SYMTH Asparagine--tRNA ligase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=asnS PE=3 SV=1 551 982 2.0E-69
sp|Q92AB2|SYN_LISIN Asparagine--tRNA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=asnS PE=3 SV=1 542 982 2.0E-68
sp|Q71YB9|SYN_LISMF Asparagine--tRNA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=asnS PE=3 SV=1 542 982 3.0E-68
sp|A5UPW5|SYN_ROSS1 Asparagine--tRNA ligase OS=Roseiflexus sp. (strain RS-1) GN=asnS PE=3 SV=1 551 982 3.0E-68
sp|A7Z5Y7|SYN_BACMF Asparagine--tRNA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=asnS PE=3 SV=1 552 982 5.0E-68
sp|P58695|SYN_LISMO Asparagine--tRNA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=asnS PE=3 SV=1 542 982 8.0E-68
sp|Q8KZT5|GBH_ARTS8 Guanidinobutyrase OS=Arthrobacter sp. (strain KUJ 8602) GN=gbh PE=1 SV=1 46 376 9.0E-68
sp|P39772|SYN_BACSU Asparagine--tRNA ligase OS=Bacillus subtilis (strain 168) GN=asnS PE=3 SV=2 552 982 1.0E-67
sp|A0AK01|SYN_LISW6 Asparagine--tRNA ligase OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=asnS PE=3 SV=1 542 982 2.0E-67
sp|Q6G9A8|SYN_STAAS Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MSSA476) GN=asnS PE=3 SV=1 565 982 2.0E-67
sp|P67572|SYN_STAAN Asparagine--tRNA ligase OS=Staphylococcus aureus (strain N315) GN=asnS PE=1 SV=1 555 982 3.0E-67
sp|P67571|SYN_STAAM Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=asnS PE=3 SV=1 555 982 3.0E-67
sp|A5ISY4|SYN_STAA9 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH9) GN=asnS PE=3 SV=1 555 982 3.0E-67
sp|A6U1S3|SYN_STAA2 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain JH1) GN=asnS PE=3 SV=1 555 982 3.0E-67
sp|A7X2E9|SYN_STAA1 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=asnS PE=3 SV=1 555 982 3.0E-67
sp|B8GBG7|SYN_CHLAD Asparagine--tRNA ligase OS=Chloroflexus aggregans (strain MD-66 / DSM 9485) GN=asnS PE=3 SV=1 552 982 4.0E-67
sp|Q8NWP3|SYN_STAAW Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MW2) GN=asnS PE=3 SV=1 565 982 9.0E-67
sp|Q88Y40|SYN1_LACPL Asparagine--tRNA ligase 1 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS1 PE=3 SV=1 540 982 1.0E-66
sp|Q6GGV5|SYN_STAAR Asparagine--tRNA ligase OS=Staphylococcus aureus (strain MRSA252) GN=asnS PE=3 SV=1 555 982 1.0E-66
sp|A8Z434|SYN_STAAT Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=asnS PE=3 SV=1 555 982 1.0E-66
sp|A6QH05|SYN_STAAE Asparagine--tRNA ligase OS=Staphylococcus aureus (strain Newman) GN=asnS PE=3 SV=1 555 982 1.0E-66
sp|Q5HFW9|SYN_STAAC Asparagine--tRNA ligase OS=Staphylococcus aureus (strain COL) GN=asnS PE=3 SV=1 555 982 1.0E-66
sp|Q2FYH6|SYN_STAA8 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=asnS PE=3 SV=1 555 982 1.0E-66
sp|Q2FGY6|SYN_STAA3 Asparagine--tRNA ligase OS=Staphylococcus aureus (strain USA300) GN=asnS PE=3 SV=1 555 982 1.0E-66
sp|B9LCU8|SYN_CHLSY Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29364 / DSM 637 / Y-400-fl) GN=asnS PE=3 SV=1 552 982 2.0E-66
sp|A9WA97|SYN_CHLAA Asparagine--tRNA ligase OS=Chloroflexus aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl) GN=asnS PE=3 SV=1 552 982 2.0E-66
sp|A7NHQ4|SYN_ROSCS Asparagine--tRNA ligase OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=asnS PE=3 SV=1 541 982 4.0E-66
sp|Q2YY52|SYN_STAAB Asparagine--tRNA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=asnS PE=3 SV=1 555 982 4.0E-66
sp|A4J412|SYN_DESRM Asparagine--tRNA ligase OS=Desulfotomaculum reducens (strain MI-1) GN=asnS PE=3 SV=1 555 982 5.0E-66
sp|Q4L6F8|SYN_STAHJ Asparagine--tRNA ligase OS=Staphylococcus haemolyticus (strain JCSC1435) GN=asnS PE=3 SV=1 565 982 9.0E-66
sp|Q49XR0|SYN_STAS1 Asparagine--tRNA ligase OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=asnS PE=3 SV=1 552 982 1.0E-65
sp|Q8F522|SYN_LEPIN Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=asnS PE=3 SV=1 554 982 6.0E-65
sp|Q72QT4|SYN_LEPIC Asparagine--tRNA ligase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=asnS PE=3 SV=1 554 982 2.0E-64
sp|Q04EX6|SYN_OENOB Asparagine--tRNA ligase OS=Oenococcus oeni (strain ATCC BAA-331 / PSU-1) GN=asnS PE=3 SV=1 540 982 2.0E-64
sp|Q38X65|SYN_LACSS Asparagine--tRNA ligase OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=asnS PE=3 SV=1 540 982 1.0E-63
sp|Q8CSI9|SYN_STAES Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=asnS PE=3 SV=1 565 982 1.0E-63
sp|Q5HP89|SYN_STAEQ Asparagine--tRNA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=asnS PE=3 SV=1 565 982 1.0E-63
sp|P54262|SYN_LACDA Asparagine--tRNA ligase OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=asnS1 PE=3 SV=1 565 982 3.0E-63
sp|Q050D9|SYN_LEPBL Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain L550) GN=asnS PE=3 SV=1 554 982 7.0E-63
sp|Q04SB3|SYN_LEPBJ Asparagine--tRNA ligase OS=Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) GN=asnS PE=3 SV=1 554 982 7.0E-63
sp|Q038W1|SYN_LACC3 Asparagine--tRNA ligase OS=Lactobacillus casei (strain ATCC 334) GN=asnS PE=3 SV=1 555 982 1.0E-62
sp|Q72KF7|SYN_THET2 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=asnS PE=3 SV=1 555 982 2.0E-62
sp|P54263|SYN_THET8 Asparagine--tRNA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=asnS PE=1 SV=2 555 982 3.0E-62
sp|A5D2C2|SYN_PELTS Asparagine--tRNA ligase OS=Pelotomaculum thermopropionicum (strain DSM 13744 / JCM 10971 / SI) GN=asnS PE=3 SV=1 552 982 4.0E-62
sp|Q88WA8|SYN2_LACPL Asparagine--tRNA ligase 2 OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=asnS2 PE=3 SV=1 554 982 2.0E-61
sp|C1CV26|SYN_DEIDV Asparagine--tRNA ligase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=asnS PE=3 SV=1 572 982 7.0E-61
sp|A9AYM5|SYN_HERA2 Asparagine--tRNA ligase OS=Herpetosiphon aurantiacus (strain ATCC 23779 / DSM 785) GN=asnS PE=3 SV=1 552 982 1.0E-60
sp|Q043G9|SYN_LACGA Asparagine--tRNA ligase OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=asnS PE=3 SV=1 542 982 2.0E-60
sp|Q74JA9|SYN_LACJO Asparagine--tRNA ligase OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=asnS PE=3 SV=1 542 982 3.0E-60
sp|A4W083|SYN_STRS2 Asparagine--tRNA ligase OS=Streptococcus suis (strain 98HAH33) GN=asnS PE=3 SV=1 552 982 1.0E-59
sp|Q1JMN3|SYN_STRPC Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS9429) GN=asnS PE=3 SV=1 540 982 2.0E-59
sp|Q1JCQ7|SYN_STRPB Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M12 (strain MGAS2096) GN=asnS PE=3 SV=1 540 982 2.0E-59
sp|P0DG29|SYN_STRPQ Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=asnS PE=3 SV=1 540 982 3.0E-59
sp|Q48UH6|SYN_STRPM Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M28 (strain MGAS6180) GN=asnS PE=3 SV=1 540 982 3.0E-59
sp|A2RFM5|SYN_STRPG Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M5 (strain Manfredo) GN=asnS PE=3 SV=1 540 982 3.0E-59
sp|Q1JHS6|SYN_STRPD Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M2 (strain MGAS10270) GN=asnS PE=3 SV=1 540 982 3.0E-59
sp|P67577|SYN_STRP8 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=asnS PE=3 SV=1 540 982 3.0E-59
sp|P0DG28|SYN_STRP3 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=asnS PE=3 SV=1 540 982 3.0E-59
sp|P67575|SYN_STRP1 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M1 GN=asnS PE=3 SV=1 540 982 3.0E-59
sp|Q1J7K5|SYN_STRPF Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M4 (strain MGAS10750) GN=asnS PE=3 SV=1 540 982 3.0E-59
sp|P67574|SYN_STRA5 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=asnS PE=3 SV=1 540 982 5.0E-59
sp|P67573|SYN_STRA3 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype III (strain NEM316) GN=asnS PE=3 SV=1 540 982 5.0E-59
sp|Q3K2E5|SYN_STRA1 Asparagine--tRNA ligase OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=asnS PE=3 SV=1 540 982 5.0E-59
sp|Q1IZA1|SYN_DEIGD Asparagine--tRNA ligase OS=Deinococcus geothermalis (strain DSM 11300) GN=asnS PE=3 SV=1 552 982 1.0E-58
sp|A3CNM0|SYN_STRSV Asparagine--tRNA ligase OS=Streptococcus sanguinis (strain SK36) GN=asnS PE=3 SV=1 540 982 1.0E-58
sp|Q5XD20|SYN_STRP6 Asparagine--tRNA ligase OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=asnS PE=3 SV=1 537 982 2.0E-58
sp|Q831X4|SYN_ENTFA Asparagine--tRNA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=asnS PE=3 SV=1 542 982 2.0E-58
sp|Q1WU36|SYN_LACS1 Asparagine--tRNA ligase OS=Lactobacillus salivarius (strain UCC118) GN=asnS PE=3 SV=1 540 982 3.0E-58
sp|A2RMQ1|SYN_LACLM Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=asnS PE=3 SV=1 552 982 6.0E-58
sp|Q02X21|SYN_LACLS Asparagine--tRNA ligase OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=asnS PE=3 SV=1 552 982 7.0E-58
sp|Q5M067|SYN_STRT1 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain CNRZ 1066) GN=asnS PE=3 SV=1 601 982 1.0E-57
sp|Q97PR0|SYN_STRPN Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=asnS PE=1 SV=1 540 982 1.0E-57
sp|A4VTZ1|SYN_STRSY Asparagine--tRNA ligase OS=Streptococcus suis (strain 05ZYH33) GN=asnS PE=3 SV=1 540 978 2.0E-57
sp|Q03L20|SYN_STRTD Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-491 / LMD-9) GN=asnS PE=3 SV=1 601 982 2.0E-57
sp|Q5M4S8|SYN_STRT2 Asparagine--tRNA ligase OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=asnS PE=3 SV=1 601 982 2.0E-57
sp|Q8CWQ4|SYN_STRR6 Asparagine--tRNA ligase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=asnS PE=3 SV=1 540 982 4.0E-57
sp|Q04JK7|SYN_STRP2 Asparagine--tRNA ligase OS=Streptococcus pneumoniae serotype 2 (strain D39 / NCTC 7466) GN=asnS PE=3 SV=1 540 982 4.0E-57
sp|A8YVJ7|SYN_LACH4 Asparagine--tRNA ligase OS=Lactobacillus helveticus (strain DPC 4571) GN=asnS PE=3 SV=1 542 982 5.0E-57
sp|Q55FI3|SYNM_DICDI Probable asparagine--tRNA ligase, mitochondrial OS=Dictyostelium discoideum GN=asnS2 PE=3 SV=1 552 981 5.0E-57
sp|Q9CEK9|SYN_LACLA Asparagine--tRNA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=asnS PE=3 SV=1 552 982 6.0E-57
sp|Q8DTM2|SYN_STRMU Asparagine--tRNA ligase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=asnS PE=3 SV=1 552 982 7.0E-57
sp|A6LIA1|SYN_PARD8 Asparagine--tRNA ligase OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=asnS PE=3 SV=1 552 975 3.0E-52
sp|Q8TXG4|SYDND_METKA Aspartate--tRNA(Asp/Asn) ligase OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=aspS PE=3 SV=1 552 982 3.0E-52
sp|Q97E56|SYN_CLOAB Asparagine--tRNA ligase OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=asnS PE=3 SV=1 552 981 5.0E-52
sp|Q5V1N2|SYDND_HALMA Aspartate--tRNA(Asp/Asn) ligase OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=aspS PE=3 SV=1 547 982 3.0E-51
sp|A0PY64|SYN_CLONN Asparagine--tRNA ligase OS=Clostridium novyi (strain NT) GN=asnS PE=3 SV=1 552 975 4.0E-51
sp|Q3IT59|SYDND_NATPD Aspartate--tRNA(Asp/Asn) ligase OS=Natronomonas pharaonis (strain ATCC 35678 / DSM 2160) GN=aspS PE=3 SV=1 548 982 4.0E-51
sp|A3DBI2|SYN_CLOTH Asparagine--tRNA ligase OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=asnS PE=3 SV=1 552 975 1.0E-50
sp|Q5L8W2|SYN_BACFN Asparagine--tRNA ligase OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=asnS PE=3 SV=1 552 975 2.0E-50
sp|Q64P24|SYN_BACFR Asparagine--tRNA ligase OS=Bacteroides fragilis (strain YCH46) GN=asnS PE=3 SV=1 552 975 2.0E-50
sp|Q8A0Z8|SYN_BACTN Asparagine--tRNA ligase OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=asnS PE=3 SV=1 552 975 5.0E-50
sp|Q899M9|SYN_CLOTE Asparagine--tRNA ligase OS=Clostridium tetani (strain Massachusetts / E88) GN=asnS PE=3 SV=1 555 975 8.0E-50
sp|Q8BGV0|SYNM_MOUSE Probable asparagine--tRNA ligase, mitochondrial OS=Mus musculus GN=Nars2 PE=1 SV=1 530 980 1.0E-49
sp|A5HZE1|SYN_CLOBH Asparagine--tRNA ligase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=asnS PE=3 SV=1 555 975 2.0E-49
sp|A7FRK8|SYN_CLOB1 Asparagine--tRNA ligase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=asnS PE=3 SV=1 555 975 2.0E-49
sp|A7GB01|SYN_CLOBL Asparagine--tRNA ligase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=asnS PE=3 SV=1 555 975 2.0E-49
sp|Q18KP5|SYDND_HALWD Aspartate--tRNA(Asp/Asn) ligase OS=Haloquadratum walsbyi (strain DSM 16790 / HBSQ001) GN=aspS PE=3 SV=1 552 982 2.0E-49
sp|A6L0U5|SYN_BACV8 Asparagine--tRNA ligase OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=asnS PE=3 SV=1 552 975 3.0E-49
sp|Q24MK1|SYN_DESHY Asparagine--tRNA ligase OS=Desulfitobacterium hafniense (strain Y51) GN=asnS PE=3 SV=1 555 975 3.0E-49
sp|Q6ANL4|SYN_DESPS Asparagine--tRNA ligase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=asnS PE=3 SV=1 555 975 8.0E-49
sp|O26328|SYDND_METTH Aspartate--tRNA(Asp/Asn) ligase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=aspS PE=1 SV=1 552 982 2.0E-48
sp|B1V8X4|SYN_PHYAS Asparagine--tRNA ligase OS=Phytoplasma australiense GN=asnS PE=3 SV=1 535 975 2.0E-48
sp|Q2NHT0|SYDND_METST Aspartate--tRNA(Asp/Asn) ligase OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=aspS PE=3 SV=1 547 982 3.0E-48
sp|Q7MVE5|SYN_PORGI Asparagine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=asnS PE=3 SV=1 549 975 4.0E-48
sp|B5ZBH7|SYN_UREU1 Asparagine--tRNA ligase OS=Ureaplasma urealyticum serovar 10 (strain ATCC 33699 / Western) GN=asnS PE=3 SV=1 535 981 4.0E-48
sp|A5N4F7|SYN_CLOK5 Asparagine--tRNA ligase OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=asnS PE=3 SV=1 555 975 7.0E-48
sp|Q58950|SYDND_METJA Aspartate--tRNA(Asp/Asn) ligase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=aspS PE=3 SV=1 552 982 9.0E-48
sp|A6USZ9|SYDND_META3 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=aspS PE=3 SV=1 552 982 1.0E-47
sp|Q7UHE1|SYN_RHOBA Asparagine--tRNA ligase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=asnS PE=3 SV=1 555 978 2.0E-47
sp|B2RK42|SYN_PORG3 Asparagine--tRNA ligase OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=asnS PE=3 SV=1 549 975 2.0E-47
sp|Q1MQG9|SYN_LAWIP Asparagine--tRNA ligase OS=Lawsonia intracellularis (strain PHE/MN1-00) GN=asnS PE=3 SV=1 553 975 2.0E-47
sp|A6UQQ8|SYDND_METVS Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=aspS PE=3 SV=1 552 982 2.0E-47
sp|Q73P19|SYN_TREDE Asparagine--tRNA ligase OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=asnS PE=3 SV=1 551 975 3.0E-47
sp|P60654|SPEB_NEIMB Agmatinase OS=Neisseria meningitidis serogroup B (strain MC58) GN=speB PE=3 SV=1 69 366 4.0E-47
sp|P60653|SPEB_NEIMA Agmatinase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=speB PE=3 SV=1 69 366 4.0E-47
sp|P0DJQ3|PAH_STRCL Proclavaminate amidinohydrolase OS=Streptomyces clavuligerus GN=pah PE=1 SV=1 46 364 7.0E-47
sp|P0DJQ4|PAH_STRC2 Proclavaminate amidinohydrolase OS=Streptomyces clavuligerus (strain ATCC 27064 / DSM 738 / JCM 4710 / NBRC 13307 / NCIMB 12785 / NRRL 3585 / VKM Ac-602) GN=pah PE=3 SV=1 46 364 7.0E-47
sp|Q8DG51|SYN_THEEB Asparagine--tRNA ligase OS=Thermosynechococcus elongatus (strain BP-1) GN=asnS PE=3 SV=1 549 981 8.0E-47
sp|B0JN99|SYN_MICAN Asparagine--tRNA ligase OS=Microcystis aeruginosa (strain NIES-843) GN=asnS PE=3 SV=1 555 975 9.0E-47
sp|Q9PQC6|SYN_UREPA Asparagine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 700970) GN=asnS PE=3 SV=1 535 981 9.0E-47
sp|B1AJ04|SYN_UREP2 Asparagine--tRNA ligase OS=Ureaplasma parvum serovar 3 (strain ATCC 27815 / 27 / NCTC 11736) GN=asnS PE=3 SV=1 535 981 9.0E-47
sp|B4RP98|SPEB_NEIG2 Agmatinase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=speB PE=3 SV=1 69 366 9.0E-47
sp|Q5F6R3|SPEB_NEIG1 Agmatinase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=speB PE=3 SV=1 69 366 9.0E-47
sp|A1KVF9|SPEB_NEIMF Agmatinase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=speB PE=3 SV=1 69 366 1.0E-46
sp|A9M254|SPEB_NEIM0 Agmatinase OS=Neisseria meningitidis serogroup C (strain 053442) GN=speB PE=3 SV=1 69 366 1.0E-46
sp|Q6KZQ3|SYD_PICTO Aspartate--tRNA(Asp) ligase OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=aspS PE=3 SV=1 555 982 1.0E-46
sp|A3CXH4|SYDND_METMJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanoculleus marisnigri (strain ATCC 35101 / DSM 1498 / JR1) GN=aspS PE=3 SV=1 556 982 1.0E-46
sp|Q8EW03|SYN_MYCPE Asparagine--tRNA ligase OS=Mycoplasma penetrans (strain HF-2) GN=asnS PE=3 SV=1 553 978 1.0E-46
sp|Q96I59|SYNM_HUMAN Probable asparagine--tRNA ligase, mitochondrial OS=Homo sapiens GN=NARS2 PE=1 SV=3 527 980 2.0E-46
sp|A1SW33|SYN_PSYIN Asparagine--tRNA ligase OS=Psychromonas ingrahamii (strain 37) GN=asnS PE=3 SV=1 552 975 4.0E-46
sp|O24822|SYDND_HALVO Aspartate--tRNA(Asp/Asn) ligase OS=Haloferax volcanii GN=aspS PE=3 SV=2 548 982 5.0E-46
sp|Q12XU7|SYDND_METBU Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcoides burtonii (strain DSM 6242 / NBRC 107633 / OCM 468 / ACE-M) GN=aspS PE=3 SV=1 546 982 5.0E-46
sp|A8MJ91|SYN_ALKOO Asparagine--tRNA ligase OS=Alkaliphilus oremlandii (strain OhILAs) GN=asnS PE=3 SV=1 552 975 5.0E-46
sp|A9NE58|SYN_ACHLI Asparagine--tRNA ligase OS=Acholeplasma laidlawii (strain PG-8A) GN=asnS PE=3 SV=1 552 975 6.0E-46
sp|P47359|SYN_MYCGE Asparagine--tRNA ligase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=asnS PE=3 SV=1 552 978 6.0E-46
sp|Q11Q97|SYN_CYTH3 Asparagine--tRNA ligase OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=asnS PE=3 SV=1 554 975 9.0E-46
sp|Q9HJM1|SYD_THEAC Aspartate--tRNA(Asp) ligase OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=aspS PE=3 SV=1 548 982 1.0E-45
sp|Q9BSE5|SPEB_HUMAN Agmatinase, mitochondrial OS=Homo sapiens GN=AGMAT PE=1 SV=2 68 371 2.0E-45
sp|O48593|SYNO_ARATH Asparagine--tRNA ligase, chloroplastic/mitochondrial OS=Arabidopsis thaliana GN=SYNO PE=2 SV=3 534 975 2.0E-45
sp|A5G5R2|SYN_GEOUR Asparagine--tRNA ligase OS=Geobacter uraniireducens (strain Rf4) GN=asnS PE=3 SV=1 552 975 2.0E-45
sp|Q7N122|SPEB_PHOLL Agmatinase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=speB PE=3 SV=1 72 366 2.0E-45
sp|A4G0V5|SYDND_METM5 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=aspS PE=3 SV=1 552 982 3.0E-45
sp|Q74E08|SYN_GEOSL Asparagine--tRNA ligase OS=Geobacter sulfurreducens (strain ATCC 51573 / DSM 12127 / PCA) GN=asnS PE=3 SV=1 552 975 4.0E-45
sp|P58693|SYN_CLOPE Asparagine--tRNA ligase OS=Clostridium perfringens (strain 13 / Type A) GN=asnS PE=3 SV=1 554 978 5.0E-45
sp|Q0TMF3|SYN_CLOP1 Asparagine--tRNA ligase OS=Clostridium perfringens (strain ATCC 13124 / DSM 756 / JCM 1290 / NCIMB 6125 / NCTC 8237 / Type A) GN=asnS PE=3 SV=1 554 978 5.0E-45
sp|Q0SQ51|SYN_CLOPS Asparagine--tRNA ligase OS=Clostridium perfringens (strain SM101 / Type A) GN=asnS PE=3 SV=1 554 978 5.0E-45
sp|P52276|SYN_SYNY3 Asparagine--tRNA ligase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=asnS PE=3 SV=2 554 975 6.0E-45
sp|Q6HCW9|SYN_BACHK Asparagine--tRNA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=asnS PE=3 SV=1 546 975 7.0E-45
sp|Q633N6|SYN_BACCZ Asparagine--tRNA ligase OS=Bacillus cereus (strain ZK / E33L) GN=asnS PE=3 SV=1 546 975 8.0E-45
sp|Q81L32|SYN_BACAN Asparagine--tRNA ligase OS=Bacillus anthracis GN=asnS PE=3 SV=1 546 975 8.0E-45
sp|A1APP8|SYN_PELPD Asparagine--tRNA ligase OS=Pelobacter propionicus (strain DSM 2379) GN=asnS PE=3 SV=1 549 975 9.0E-45
sp|Q6LWU0|SYDND_METMP Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain S2 / LL) GN=aspS PE=3 SV=1 552 982 1.0E-44
sp|Q72ZI3|SYN_BACC1 Asparagine--tRNA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=asnS PE=3 SV=1 546 975 1.0E-44
sp|Q9I6K2|GPUA_PSEAE Guanidinopropionase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gpuA PE=1 SV=1 46 375 1.0E-44
sp|O58776|SYD_PYRHO Aspartate--tRNA(Asp) ligase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=aspS PE=3 SV=1 550 982 1.0E-44
sp|A6VHK5|SYDND_METM7 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=aspS PE=3 SV=1 552 982 2.0E-44
sp|Q98PF2|SYN_MYCPU Asparagine--tRNA ligase OS=Mycoplasma pulmonis (strain UAB CTIP) GN=asnS PE=3 SV=1 553 975 2.0E-44
sp|Q7P0S6|SPEB_CHRVO Agmatinase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=speB PE=3 SV=1 46 347 3.0E-44
sp|A9A945|SYDND_METM6 Aspartate--tRNA(Asp/Asn) ligase OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=aspS PE=3 SV=1 552 982 3.0E-44
sp|Q023P9|SYN_SOLUE Asparagine--tRNA ligase OS=Solibacter usitatus (strain Ellin6076) GN=asnS PE=3 SV=1 552 981 3.0E-44
sp|Q5QZ13|SYN_IDILO Asparagine--tRNA ligase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=asnS PE=3 SV=1 665 975 3.0E-44
sp|Q081Q0|SYN_SHEFN Asparagine--tRNA ligase OS=Shewanella frigidimarina (strain NCIMB 400) GN=asnS PE=3 SV=1 547 975 4.0E-44
sp|Q7X3P1|SPEB_PROMI Agmatinase OS=Proteus mirabilis GN=speB PE=3 SV=2 69 366 4.0E-44
sp|B4F1A3|SPEB_PROMH Agmatinase OS=Proteus mirabilis (strain HI4320) GN=speB PE=3 SV=1 69 366 4.0E-44
sp|B0BNV4|SYN_ACTPJ Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=asnS PE=3 SV=1 552 975 5.0E-44
sp|Q5H049|SYN_XANOR Asparagine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=asnS PE=3 SV=1 551 975 6.0E-44
sp|Q9I3S3|GBUA_PSEAE Guanidinobutyrase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=gbuA PE=1 SV=1 46 369 6.0E-44
sp|Q9P6I0|SYNM_SCHPO Asparagine--tRNA ligase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slm5 PE=3 SV=1 552 978 7.0E-44
sp|Q8RH70|SYN_FUSNN Asparagine--tRNA ligase OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=asnS PE=3 SV=1 547 975 7.0E-44
sp|A8GIX7|SPEB_SERP5 Agmatinase OS=Serratia proteamaculans (strain 568) GN=speB PE=3 SV=1 72 375 7.0E-44
sp|Q15UN9|SYN_PSEA6 Asparagine--tRNA ligase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=asnS PE=3 SV=1 658 981 8.0E-44
sp|Q2P326|SYN_XANOM Asparagine--tRNA ligase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=asnS PE=3 SV=1 551 975 8.0E-44
sp|Q0HUL3|SYN_SHESR Asparagine--tRNA ligase OS=Shewanella sp. (strain MR-7) GN=asnS PE=3 SV=1 547 975 9.0E-44
sp|Q481G3|SYN_COLP3 Asparagine--tRNA ligase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=asnS PE=3 SV=1 658 975 9.0E-44
sp|Q52428|SYD_THEKO Aspartate--tRNA(Asp) ligase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=aspS PE=1 SV=2 661 982 1.0E-43
sp|B3H198|SYN_ACTP7 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=asnS PE=3 SV=1 552 975 1.0E-43
sp|A3N039|SYN_ACTP2 Asparagine--tRNA ligase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=asnS PE=3 SV=1 552 975 1.0E-43
sp|A1S684|SYN_SHEAM Asparagine--tRNA ligase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=asnS PE=3 SV=1 547 975 1.0E-43
sp|A6VNV7|SYN_ACTSZ Asparagine--tRNA ligase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=asnS PE=3 SV=1 547 975 1.0E-43
sp|Q7VRG4|SPEB_BLOFL Agmatinase OS=Blochmannia floridanus GN=speB PE=3 SV=1 69 371 2.0E-43
sp|Q466Y5|SYDND_METBF Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina barkeri (strain Fusaro / DSM 804) GN=aspS PE=3 SV=1 552 982 2.0E-43
sp|Q12MT5|SYN_SHEDO Asparagine--tRNA ligase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=asnS PE=3 SV=1 546 975 2.0E-43
sp|A0KXL6|SYN_SHESA Asparagine--tRNA ligase OS=Shewanella sp. (strain ANA-3) GN=asnS PE=3 SV=1 547 975 2.0E-43
sp|Q8PM16|SYN_XANAC Asparagine--tRNA ligase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=asnS PE=3 SV=1 551 975 2.0E-43
sp|A8FVU8|SYN_SHESH Asparagine--tRNA ligase OS=Shewanella sediminis (strain HAW-EB3) GN=asnS PE=3 SV=1 547 975 2.0E-43
sp|Q6D453|SYN_PECAS Asparagine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=asnS PE=3 SV=1 553 975 2.0E-43
sp|Q65TR1|SYN_MANSM Asparagine--tRNA ligase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=asnS PE=3 SV=1 552 975 2.0E-43
sp|Q979P6|SYD_THEVO Aspartate--tRNA(Asp) ligase OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=aspS PE=3 SV=1 555 982 3.0E-43
sp|Q1DA04|SYN_MYXXD Asparagine--tRNA ligase OS=Myxococcus xanthus (strain DK 1622) GN=asnS PE=3 SV=1 551 978 4.0E-43
sp|Q817I8|SYN_BACCR Asparagine--tRNA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=asnS PE=3 SV=1 555 975 5.0E-43
sp|A7GTK8|SYN_BACCN Asparagine--tRNA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=asnS PE=3 SV=1 554 981 5.0E-43
sp|Q90XD2|SPEB_CHICK Agmatinase, mitochondrial OS=Gallus gallus GN=AGMAT PE=2 SV=1 68 369 7.0E-43
sp|Q39SY7|SYN_GEOMG Asparagine--tRNA ligase OS=Geobacter metallireducens (strain GS-15 / ATCC 53774 / DSM 7210) GN=asnS PE=3 SV=1 547 975 7.0E-43
sp|Q3BV23|SYN_XANC5 Asparagine--tRNA ligase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=asnS PE=3 SV=1 551 975 8.0E-43
sp|O29342|SYDND_ARCFU Aspartate--tRNA(Asp/Asn) ligase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=aspS PE=3 SV=1 550 982 9.0E-43
sp|A6TVS9|SYN_ALKMQ Asparagine--tRNA ligase OS=Alkaliphilus metalliredigens (strain QYMF) GN=asnS PE=3 SV=1 552 975 9.0E-43
sp|A1V9B8|SYN_DESVV Asparagine--tRNA ligase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=asnS PE=3 SV=1 555 978 1.0E-42
sp|Q72G53|SYN_DESVH Asparagine--tRNA ligase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=asnS PE=3 SV=1 555 978 1.0E-42
sp|Q8PAC4|SYN_XANCP Asparagine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=asnS PE=3 SV=1 551 975 1.0E-42
sp|Q4UTA1|SYN_XANC8 Asparagine--tRNA ligase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=asnS PE=3 SV=1 551 975 1.0E-42
sp|A8APF8|SPEB_CITK8 Agmatinase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=speB PE=3 SV=1 69 347 1.0E-42
sp|A7MJQ1|SPEB_CROS8 Agmatinase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=speB PE=3 SV=1 72 347 1.0E-42
sp|B0UTU8|SYN_HISS2 Asparagine--tRNA ligase OS=Histophilus somni (strain 2336) GN=asnS PE=3 SV=1 552 975 2.0E-42
sp|Q0HIB6|SYN_SHESM Asparagine--tRNA ligase OS=Shewanella sp. (strain MR-4) GN=asnS PE=3 SV=1 547 975 2.0E-42
sp|Q6MEC9|SYN_PARUW Asparagine--tRNA ligase OS=Protochlamydia amoebophila (strain UWE25) GN=asnS PE=3 SV=1 552 979 2.0E-42
sp|A4WE75|SPEB_ENT38 Agmatinase OS=Enterobacter sp. (strain 638) GN=speB PE=3 SV=1 69 347 2.0E-42
sp|A8GCJ5|SYN_SERP5 Asparagine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=asnS PE=3 SV=1 547 975 2.0E-42
sp|B7NI01|SPEB_ECO7I Agmatinase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=speB PE=3 SV=1 69 347 3.0E-42
sp|A9KZ30|SYN_SHEB9 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS195) GN=asnS PE=3 SV=1 547 975 4.0E-42
sp|Q0I2M9|SYN_HAES1 Asparagine--tRNA ligase OS=Haemophilus somnus (strain 129Pt) GN=asnS PE=3 SV=1 552 975 4.0E-42
sp|A3D3V7|SYN_SHEB5 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=asnS PE=3 SV=1 547 975 5.0E-42
sp|P75521|SYN_MYCPN Asparagine--tRNA ligase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=asnS PE=3 SV=1 551 978 5.0E-42
sp|Q8Q0R2|SYDND_METMA Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=aspS PE=1 SV=1 551 982 5.0E-42
sp|Q2FRU5|SYDND_METHJ Aspartate--tRNA(Asp/Asn) ligase OS=Methanospirillum hungatei JF-1 (strain ATCC 27890 / DSM 864 / NBRC 100397 / JF-1) GN=aspS PE=3 SV=1 556 982 5.0E-42
sp|A6WMP4|SYN_SHEB8 Asparagine--tRNA ligase OS=Shewanella baltica (strain OS185) GN=asnS PE=3 SV=1 547 975 6.0E-42
sp|Q3YXT4|SPEB_SHISS Agmatinase OS=Shigella sonnei (strain Ss046) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|P60656|SPEB_SALTY Agmatinase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|P60655|SPEB_SALTI Agmatinase OS=Salmonella typhi GN=speB PE=3 SV=1 69 347 6.0E-42
sp|B4TV53|SPEB_SALSV Agmatinase OS=Salmonella schwarzengrund (strain CVM19633) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|B5BFP3|SPEB_SALPK Agmatinase OS=Salmonella paratyphi A (strain AKU_12601) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|C0PY54|SPEB_SALPC Agmatinase OS=Salmonella paratyphi C (strain RKS4594) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|A9N3R6|SPEB_SALPB Agmatinase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|Q5PJH7|SPEB_SALPA Agmatinase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|B4T5I5|SPEB_SALNS Agmatinase OS=Salmonella newport (strain SL254) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|B4THG3|SPEB_SALHS Agmatinase OS=Salmonella heidelberg (strain SL476) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|Q57K36|SPEB_SALCH Agmatinase OS=Salmonella choleraesuis (strain SC-B67) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|B5F5K3|SPEB_SALA4 Agmatinase OS=Salmonella agona (strain SL483) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|B5RE39|SPEB_SALG2 Agmatinase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|B5QXK5|SPEB_SALEP Agmatinase OS=Salmonella enteritidis PT4 (strain P125109) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|B5FUJ0|SPEB_SALDC Agmatinase OS=Salmonella dublin (strain CT_02021853) GN=speB PE=3 SV=1 69 347 6.0E-42
sp|A1RK52|SYN_SHESW Asparagine--tRNA ligase OS=Shewanella sp. (strain W3-18-1) GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|A4Y6E4|SYN_SHEPC Asparagine--tRNA ligase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|Q66CG7|SYN_YERPS Asparagine--tRNA ligase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|A4TMZ6|SYN_YERPP Asparagine--tRNA ligase OS=Yersinia pestis (strain Pestoides F) GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|Q1CGI7|SYN_YERPN Asparagine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|P58697|SYN_YERPE Asparagine--tRNA ligase OS=Yersinia pestis GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|Q1CA47|SYN_YERPA Asparagine--tRNA ligase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|A7FJU5|SYN_YERP3 Asparagine--tRNA ligase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|Q3IGU4|SYN_PSEHT Asparagine--tRNA ligase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=asnS PE=3 SV=1 658 978 7.0E-42
sp|Q8U2G6|SYD_PYRFU Aspartate--tRNA(Asp) ligase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=aspS PE=3 SV=1 548 982 7.0E-42
sp|Q7VLL7|SYN_HAEDU Asparagine--tRNA ligase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=asnS PE=3 SV=1 547 975 7.0E-42
sp|A2SPG1|SYDND_METLZ Aspartate--tRNA(Asp/Asn) ligase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=aspS PE=3 SV=1 556 982 8.0E-42
sp|A0LL53|SYN_SYNFM Asparagine--tRNA ligase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=asnS PE=3 SV=1 552 981 9.0E-42
sp|Q1R791|SPEB_ECOUT Agmatinase OS=Escherichia coli (strain UTI89 / UPEC) GN=speB PE=3 SV=1 69 347 1.0E-41
sp|Q8FE36|SPEB_ECOL6 Agmatinase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=speB PE=3 SV=1 69 347 1.0E-41
sp|Q0TDR4|SPEB_ECOL5 Agmatinase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=speB PE=3 SV=1 69 347 1.0E-41
sp|A1AFC5|SPEB_ECOK1 Agmatinase OS=Escherichia coli O1:K1 / APEC GN=speB PE=3 SV=1 69 347 1.0E-41
sp|B7MZN5|SPEB_ECO81 Agmatinase OS=Escherichia coli O81 (strain ED1a) GN=speB PE=3 SV=1 69 347 1.0E-41
sp|B7MMC5|SPEB_ECO45 Agmatinase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=speB PE=3 SV=1 69 347 1.0E-41
sp|B7UHY3|SPEB_ECO27 Agmatinase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=speB PE=3 SV=1 69 347 1.0E-41
sp|B2TI01|SYN_CLOBB Asparagine--tRNA ligase OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=asnS PE=3 SV=1 546 975 1.0E-41
sp|B0TUU1|SYN_SHEHH Asparagine--tRNA ligase OS=Shewanella halifaxensis (strain HAW-EB4) GN=asnS PE=3 SV=1 547 975 1.0E-41
sp|B2UXS0|SYN_CLOBA Asparagine--tRNA ligase OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=asnS PE=3 SV=1 546 975 1.0E-41
sp|Q32C02|SPEB_SHIDS Agmatinase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|Q8EEZ1|SYN_SHEON Asparagine--tRNA ligase OS=Shewanella oneidensis (strain MR-1) GN=asnS PE=3 SV=1 547 975 2.0E-41
sp|Q8TQ68|SYDND_METAC Aspartate--tRNA(Asp/Asn) ligase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=aspS PE=3 SV=1 552 982 2.0E-41
sp|B2U0V8|SPEB_SHIB3 Agmatinase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|P60657|SPEB_SHIFL Agmatinase OS=Shigella flexneri GN=speB PE=3 SV=1 69 347 2.0E-41
sp|Q0T0V7|SPEB_SHIF8 Agmatinase OS=Shigella flexneri serotype 5b (strain 8401) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|Q31WK0|SPEB_SHIBS Agmatinase OS=Shigella boydii serotype 4 (strain Sb227) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|B7LPE7|SPEB_ESCF3 Agmatinase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|B1LDE6|SPEB_ECOSM Agmatinase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|B7N7I9|SPEB_ECOLU Agmatinase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|P60651|SPEB_ECOLI Agmatinase OS=Escherichia coli (strain K12) GN=speB PE=1 SV=1 69 347 2.0E-41
sp|B1IT67|SPEB_ECOLC Agmatinase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|B1XF99|SPEB_ECODH Agmatinase OS=Escherichia coli (strain K12 / DH10B) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|C5A0K6|SPEB_ECOBW Agmatinase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|B7LYW6|SPEB_ECO8A Agmatinase OS=Escherichia coli O8 (strain IAI1) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|B5YQD4|SPEB_ECO5E Agmatinase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|P60652|SPEB_ECO57 Agmatinase OS=Escherichia coli O157:H7 GN=speB PE=3 SV=1 69 347 2.0E-41
sp|A7ZR59|SPEB_ECO24 Agmatinase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|A6TDU9|SPEB_KLEP7 Agmatinase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|B5XUB2|SPEB_KLEP3 Agmatinase OS=Klebsiella pneumoniae (strain 342) GN=speB PE=3 SV=1 69 347 2.0E-41
sp|A8H467|SYN_SHEPA Asparagine--tRNA ligase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=asnS PE=3 SV=1 547 975 3.0E-41
sp|B6I775|SPEB_ECOSE Agmatinase OS=Escherichia coli (strain SE11) GN=speB PE=3 SV=1 69 347 4.0E-41
sp|B7LFJ6|SPEB_ECO55 Agmatinase OS=Escherichia coli (strain 55989 / EAEC) GN=speB PE=3 SV=1 69 347 4.0E-41
sp|Q317J6|SYN_DESAG Asparagine--tRNA ligase OS=Desulfovibrio alaskensis (strain G20) GN=asnS PE=3 SV=1 555 975 4.0E-41
sp|Q976I3|SYDND_SULTO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=aspS PE=1 SV=1 552 982 4.0E-41
sp|Q4A7W9|SYN_MYCH7 Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 7448) GN=asnS PE=3 SV=1 554 975 4.0E-41
sp|Q6F0Y5|SYN_MESFL Asparagine--tRNA ligase OS=Mesoplasma florum (strain ATCC 33453 / NBRC 100688 / NCTC 11704 / L1) GN=asnS PE=3 SV=1 548 975 5.0E-41
sp|Q9CN06|SYN_PASMU Asparagine--tRNA ligase OS=Pasteurella multocida (strain Pm70) GN=asnS PE=3 SV=2 552 975 5.0E-41
sp|Q87NH5|SYN_VIBPA Asparagine--tRNA ligase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=asnS PE=3 SV=1 553 975 5.0E-41
sp|A1JMN8|SYN_YERE8 Asparagine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=asnS PE=3 SV=1 665 975 7.0E-41
sp|Q5E5P2|SYN_VIBF1 Asparagine--tRNA ligase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=asnS PE=3 SV=1 553 975 7.0E-41
sp|Q8D2U1|SYN_WIGBR Asparagine--tRNA ligase OS=Wigglesworthia glossinidia brevipalpis GN=asnS PE=3 SV=1 555 975 9.0E-41
sp|P58696|SYN_SALTY Asparagine--tRNA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=asnS PE=3 SV=2 665 975 9.0E-41
sp|Q1LT63|SYN_BAUCH Asparagine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=asnS PE=3 SV=1 571 975 1.0E-40
sp|P25345|SYNM_YEAST Asparagine--tRNA ligase, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SLM5 PE=1 SV=1 555 968 1.0E-40
sp|A6T726|SYN_KLEP7 Asparagine--tRNA ligase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=asnS PE=3 SV=1 665 975 1.0E-40
sp|P43829|SYN_HAEIN Asparagine--tRNA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=asnS PE=3 SV=2 552 975 1.0E-40
sp|A5UCB9|SYN_HAEIE Asparagine--tRNA ligase OS=Haemophilus influenzae (strain PittEE) GN=asnS PE=3 SV=1 552 975 1.0E-40
sp|Q9Y9U7|SYDND_AERPE Aspartate--tRNA(Asp/Asn) ligase OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=aspS PE=3 SV=2 537 982 1.0E-40
sp|A5UF16|SYN_HAEIG Asparagine--tRNA ligase OS=Haemophilus influenzae (strain PittGG) GN=asnS PE=3 SV=1 552 975 1.0E-40
sp|Q600N9|SYN_MYCH2 Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain 232) GN=asnS PE=3 SV=1 554 975 1.0E-40
sp|Q7MJS0|SYN_VIBVY Asparagine--tRNA ligase OS=Vibrio vulnificus (strain YJ016) GN=asnS PE=3 SV=1 553 975 1.0E-40
sp|Q8DAF0|SYN_VIBVU Asparagine--tRNA ligase OS=Vibrio vulnificus (strain CMCP6) GN=asnS PE=3 SV=1 553 975 1.0E-40
sp|Q4A9S1|SYN_MYCHJ Asparagine--tRNA ligase OS=Mycoplasma hyopneumoniae (strain J / ATCC 25934 / NCTC 10110) GN=asnS PE=3 SV=1 554 975 1.0E-40
sp|Q9V036|SYD_PYRAB Aspartate--tRNA(Asp) ligase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=aspS PE=3 SV=1 550 982 1.0E-40
sp|A4W8U9|SYN_ENT38 Asparagine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=asnS PE=3 SV=1 555 975 2.0E-40
sp|Q56112|SYN_SALTI Asparagine--tRNA ligase OS=Salmonella typhi GN=asnS PE=3 SV=3 665 975 2.0E-40
sp|Q5PGF0|SYN_SALPA Asparagine--tRNA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=asnS PE=3 SV=1 665 975 2.0E-40
sp|B8F3Y5|SYN_HAEPS Asparagine--tRNA ligase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=asnS PE=3 SV=1 552 975 2.0E-40
sp|Q6LPQ6|SYN_PHOPR Asparagine--tRNA ligase OS=Photobacterium profundum GN=asnS PE=3 SV=1 553 975 2.0E-40
sp|P59517|SYN_BUCBP Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=asnS PE=3 SV=1 540 975 2.0E-40
sp|A8A477|SPEB_ECOHS Agmatinase OS=Escherichia coli O9:H4 (strain HS) GN=speB PE=3 SV=1 69 347 2.0E-40
sp|A5IE87|SYN_LEGPC Asparagine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=asnS PE=3 SV=1 546 975 3.0E-40
sp|Q57QZ8|SYN_SALCH Asparagine--tRNA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=asnS PE=3 SV=1 665 975 3.0E-40
sp|Q2NRD3|SPEB_SODGM Agmatinase OS=Sodalis glossinidius (strain morsitans) GN=speB PE=3 SV=1 69 373 3.0E-40
sp|A3QE68|SYN_SHELP Asparagine--tRNA ligase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=asnS PE=3 SV=1 547 975 3.0E-40
sp|P58692|SYN_NOSS1 Asparagine--tRNA ligase OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=asnS PE=3 SV=1 665 975 4.0E-40
sp|Q9KSF9|SYN_VIBCH Asparagine--tRNA ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=asnS PE=3 SV=2 553 975 5.0E-40
sp|Q87A82|SYN_XYLFT Asparagine--tRNA ligase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=asnS PE=3 SV=1 658 975 5.0E-40
sp|A0KIC3|SYN_AERHH Asparagine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=asnS PE=3 SV=1 665 975 5.0E-40
sp|Q980V3|SYDND_SULSO Aspartate--tRNA(Asp/Asn) ligase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=aspS PE=3 SV=1 552 982 5.0E-40
sp|Q9PAF5|SYN_XYLFA Asparagine--tRNA ligase OS=Xylella fastidiosa (strain 9a5c) GN=asnS PE=3 SV=1 658 975 6.0E-40
sp|Q6YPH3|SYN_ONYPE Asparagine--tRNA ligase OS=Onion yellows phytoplasma (strain OY-M) GN=asnS PE=3 SV=1 554 975 7.0E-40
sp|Q5X300|SYN_LEGPA Asparagine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=asnS PE=3 SV=1 665 975 9.0E-40
sp|Q9SW96|SYNC1_ARATH Asparagine--tRNA ligase, cytoplasmic 1 OS=Arabidopsis thaliana GN=SYNC1 PE=1 SV=1 720 979 9.0E-40
sp|Q5WUG0|SYN_LEGPL Asparagine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=asnS PE=3 SV=1 665 975 1.0E-39
sp|Q3SYZ4|SYDC_BOVIN Aspartate--tRNA ligase, cytoplasmic OS=Bos taurus GN=DARS PE=2 SV=1 530 982 1.0E-39
sp|Q2SR42|SYN_MYCCT Asparagine--tRNA ligase OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=asnS PE=3 SV=1 555 975 1.0E-39
sp|Q6MUF2|SYN_MYCMS Asparagine--tRNA ligase OS=Mycoplasma mycoides subsp. mycoides SC (strain PG1) GN=asnS PE=3 SV=1 549 975 1.0E-39
sp|P15178|SYDC_RAT Aspartate--tRNA ligase, cytoplasmic OS=Rattus norvegicus GN=Dars PE=2 SV=1 530 982 1.0E-39
sp|B2S3J9|SYN_TREPS Asparagine--tRNA ligase OS=Treponema pallidum subsp. pallidum (strain SS14) GN=asnS PE=3 SV=1 557 975 2.0E-39
sp|O83618|SYN_TREPA Asparagine--tRNA ligase OS=Treponema pallidum (strain Nichols) GN=asnS PE=3 SV=1 557 975 2.0E-39
sp|Q922B2|SYDC_MOUSE Aspartate--tRNA ligase, cytoplasmic OS=Mus musculus GN=Dars PE=1 SV=2 530 982 2.0E-39
sp|Q7NBM9|SYN_MYCGA Asparagine--tRNA ligase OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=asnS PE=3 SV=2 658 979 2.0E-39
sp|O07683|SYDND_HALSA Aspartate--tRNA(Asp/Asn) ligase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=aspS PE=1 SV=1 552 982 2.0E-39
sp|Q32E51|SYN_SHIDS Asparagine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=asnS PE=3 SV=1 553 975 3.0E-39
sp|Q2SJV9|SYN_HAHCH Asparagine--tRNA ligase OS=Hahella chejuensis (strain KCTC 2396) GN=asnS PE=3 SV=1 552 975 3.0E-39
sp|B1XKH1|SYN_SYNP2 Asparagine--tRNA ligase OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=asnS PE=3 SV=1 555 975 4.0E-39
sp|Q3Z3J0|SYN_SHISS Asparagine--tRNA ligase OS=Shigella sonnei (strain Ss046) GN=asnS PE=3 SV=1 553 975 4.0E-39
sp|P0A8M2|SYN_SHIFL Asparagine--tRNA ligase OS=Shigella flexneri GN=asnS PE=3 SV=2 553 975 4.0E-39
sp|Q0T6B1|SYN_SHIF8 Asparagine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=asnS PE=3 SV=1 553 975 4.0E-39
sp|Q31YR7|SYN_SHIBS Asparagine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=asnS PE=3 SV=1 553 975 4.0E-39
sp|Q1RDS7|SYN_ECOUT Asparagine--tRNA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=asnS PE=3 SV=1 553 975 4.0E-39
sp|P0A8M0|SYN_ECOLI Asparagine--tRNA ligase OS=Escherichia coli (strain K12) GN=asnS PE=1 SV=2 553 975 4.0E-39
sp|B1IW01|SYN_ECOLC Asparagine--tRNA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=asnS PE=3 SV=1 553 975 4.0E-39
sp|P0A8M1|SYN_ECOL6 Asparagine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=asnS PE=3 SV=2 553 975 4.0E-39
sp|Q0TJC3|SYN_ECOL5 Asparagine--tRNA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=asnS PE=3 SV=1 553 975 4.0E-39
sp|A7ZYN3|SYN_ECOHS Asparagine--tRNA ligase OS=Escherichia coli O9:H4 (strain HS) GN=asnS PE=3 SV=1 553 975 4.0E-39
sp|A7ZK21|SYN_ECO24 Asparagine--tRNA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=asnS PE=3 SV=1 553 975 4.0E-39
sp|C5BAV1|SPEB_EDWI9 Agmatinase OS=Edwardsiella ictaluri (strain 93-146) GN=speB PE=3 SV=1 69 347 5.0E-39
sp|B3R0I1|SYN_PHYMT Asparagine--tRNA ligase OS=Phytoplasma mali (strain AT) GN=asnS PE=3 SV=1 551 974 5.0E-39
sp|Q7N622|SYN_PHOLL Asparagine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=asnS PE=3 SV=1 553 975 6.0E-39
sp|Q8ZYM8|SYD_PYRAE Aspartate--tRNA(Asp) ligase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=aspS PE=1 SV=1 549 982 1.0E-38
sp|P58694|SYN_ECO57 Asparagine--tRNA ligase OS=Escherichia coli O157:H7 GN=asnS PE=3 SV=2 553 975 1.0E-38
sp|Q7VR09|SYN_BLOFL Asparagine--tRNA ligase OS=Blochmannia floridanus GN=asnS PE=3 SV=1 535 975 3.0E-38
sp|B6YRL1|SYN_AZOPC Asparagine--tRNA ligase OS=Azobacteroides pseudotrichonymphae genomovar. CFP2 GN=asnS PE=3 SV=1 554 975 3.0E-38
sp|Q492P3|SYN_BLOPB Asparagine--tRNA ligase OS=Blochmannia pennsylvanicus (strain BPEN) GN=asnS PE=3 SV=1 665 975 3.0E-38
sp|Q0D2L3|SPEB_RAT Agmatinase, mitochondrial OS=Rattus norvegicus GN=Agmat PE=2 SV=1 68 371 4.0E-38
sp|Q8K9I7|SYN_BUCAP Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=asnS PE=3 SV=1 548 975 4.0E-38
sp|Q2NIF5|SYN_AYWBP Asparagine--tRNA ligase OS=Aster yellows witches'-broom phytoplasma (strain AYWB) GN=asnS PE=3 SV=1 554 975 6.0E-38
sp|Q03577|SYDC_CAEEL Aspartate--tRNA ligase, cytoplasmic OS=Caenorhabditis elegans GN=drs-1 PE=3 SV=1 557 982 8.0E-38
sp|Q5R9I5|SYDC_PONAB Aspartate--tRNA ligase, cytoplasmic OS=Pongo abelii GN=DARS PE=2 SV=1 557 982 8.0E-38
sp|B3PNG8|SYN_MYCA5 Asparagine--tRNA ligase OS=Mycoplasma arthritidis (strain 158L3-1) GN=asnS PE=3 SV=1 556 981 8.0E-38
sp|P57441|SYN_BUCAI Asparagine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=asnS PE=3 SV=1 548 975 2.0E-37
sp|P14868|SYDC_HUMAN Aspartate--tRNA ligase, cytoplasmic OS=Homo sapiens GN=DARS PE=1 SV=2 530 982 2.0E-37
sp|Q5SIC2|SYDND_THET8 Aspartate--tRNA(Asp/Asn) ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=aspS2 PE=1 SV=1 552 982 4.0E-37
sp|Q2NU85|SYN_SODGM Asparagine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=asnS PE=3 SV=1 665 975 6.0E-37
sp|A6LPI6|SYN_CLOB8 Asparagine--tRNA ligase OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=asnS PE=3 SV=1 665 975 8.0E-37
sp|A2AS89|SPEB_MOUSE Agmatinase, mitochondrial OS=Mus musculus GN=Agmat PE=1 SV=1 68 371 2.0E-36
sp|Q9SSK1|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=1 SV=1 720 979 4.0E-36
sp|O51128|SYN_BORBU Asparagine--tRNA ligase OS=Borrelia burgdorferi (strain ATCC 35210 / B31 / CIP 102532 / DSM 4680) GN=asnS PE=3 SV=2 550 975 8.0E-36
sp|Q662R1|SYN_BORBP Asparagine--tRNA ligase OS=Borrelia bavariensis (strain ATCC BAA-2496 / DSM 23469 / PBi) GN=asnS PE=3 SV=1 550 975 5.0E-35
sp|Q9RVH4|SYDND_DEIRA Aspartate--tRNA(Asp/Asn) ligase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=aspS2 PE=1 SV=1 551 982 6.0E-35
sp|Q0SP63|SYN_BORAP Asparagine--tRNA ligase OS=Borrelia afzelii (strain PKo) GN=asnS PE=3 SV=1 550 975 8.0E-35
sp|P41908|SYNC_SACPA Asparagine--tRNA ligase, cytoplasmic (Fragment) OS=Saccharomyces paradoxus GN=DED81 PE=3 SV=1 896 982 3.0E-34
sp|Q8SRQ8|SYDC_ENCCU Probable aspartate--tRNA ligase, cytoplasmic OS=Encephalitozoon cuniculi (strain GB-M1) GN=ECU06_0790 PE=3 SV=1 546 982 3.0E-32
sp|Q6KHD7|SYN_MYCMO Asparagine--tRNA ligase OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=asnS PE=3 SV=1 665 975 2.0E-31
sp|B7XHQ4|SYDC_ENTBH Probable aspartate--tRNA ligase, cytoplasmic OS=Enterocytozoon bieneusi (strain H348) GN=EBI_21705 PE=3 SV=1 548 982 5.0E-31
sp|P04802|SYDC_YEAST Aspartate--tRNA ligase, cytoplasmic OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DPS1 PE=1 SV=3 473 982 2.0E-30
sp|Q8H104|SYDC1_ARATH Aspartate--tRNA ligase 1, cytoplasmic OS=Arabidopsis thaliana GN=At4g26870 PE=2 SV=1 550 982 6.0E-30
sp|Q75JQ1|SYDC1_DICDI Aspartate--tRNA ligase, cytoplasmic 1 OS=Dictyostelium discoideum GN=aspS1 PE=3 SV=1 661 982 2.0E-28
sp|P73270|SPEB2_SYNY3 Probable agmatinase 2 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=speB2 PE=3 SV=1 46 373 3.0E-28
sp|O74407|SYDC_SCHPO Aspartate--tRNA ligase, cytoplasmic OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dps1 PE=1 SV=1 661 982 6.0E-28
sp|Q9M084|SYDC2_ARATH Aspartate--tRNA ligase 2, cytoplasmic OS=Arabidopsis thaliana GN=IBI1 PE=1 SV=1 553 982 1.0E-26
sp|Q9K6B9|SPEB_BACHD Agmatinase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=speB PE=3 SV=2 72 370 1.0E-26
sp|Q81JT1|SPEB_BACAN Agmatinase OS=Bacillus anthracis GN=speB PE=3 SV=1 69 371 4.0E-26
sp|Q814Q2|SPEB_BACCR Agmatinase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=speB PE=3 SV=1 70 371 5.0E-26
sp|P70999|SPEB_BACSU Agmatinase OS=Bacillus subtilis (strain 168) GN=speB PE=1 SV=1 69 371 2.0E-25
sp|Q57757|Y309_METJA Uncharacterized protein MJ0309 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=MJ0309 PE=3 SV=1 64 366 4.0E-25
sp|P46637|ARGI1_ARATH Arginase 1, mitochondrial OS=Arabidopsis thaliana GN=ARGAH1 PE=2 SV=1 71 371 7.0E-25
sp|Q7X7N2|ARGI1_ORYSJ Arginase 1, mitochondrial OS=Oryza sativa subsp. japonica GN=ARG1 PE=2 SV=1 66 371 2.0E-24
sp|B8AU84|ARGI1_ORYSI Arginase 1, mitochondrial OS=Oryza sativa subsp. indica GN=B0616E02-H0507E05.7 PE=1 SV=1 66 371 3.0E-24
sp|P19268|YHMF_METFE Uncharacterized 32.2 kDa protein in hmfB 3'region OS=Methanothermus fervidus PE=3 SV=1 71 369 9.0E-24
sp|Q72JK8|SPEBH_THET2 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=TT_C0764 PE=1 SV=1 64 366 9.0E-24
sp|Q9ZPF5|ARGI2_ARATH Arginase 2, mitochondrial OS=Arabidopsis thaliana GN=ARGAH2 PE=2 SV=1 71 371 1.0E-23
sp|O49046|ARGI_SOYBN Arginase OS=Glycine max GN=AG1 PE=2 SV=1 72 371 2.0E-23
sp|Q5JI38|SPEBH_THEKO N(1)-aminopropylagmatine ureohydrolase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=TK0882 PE=1 SV=1 61 373 4.0E-23
sp|Q5SJ85|SEPBH_THET8 N(1)-aminopropylagmatine ureohydrolase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA1129 PE=1 SV=1 64 366 7.0E-23
sp|Q9SW95|SYNC2_ARATH Asparagine--tRNA ligase, cytoplasmic 2 OS=Arabidopsis thaliana GN=SYNC2 PE=1 SV=2 588 980 2.0E-21
sp|P57512|SYK_BUCAI Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=lysS PE=3 SV=1 499 974 8.0E-18
sp|A0KNK7|SYK_AERHH Lysine--tRNA ligase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=lysS PE=3 SV=1 528 974 3.0E-16
sp|Q1E180|ARGI_COCIM Arginase OS=Coccidioides immitis (strain RS) GN=ARG PE=3 SV=1 163 362 4.0E-16
sp|A4SJK0|SYK_AERS4 Lysine--tRNA ligase OS=Aeromonas salmonicida (strain A449) GN=lysS PE=3 SV=1 538 974 4.0E-16
sp|P40906|ARGI_COCP7 Arginase OS=Coccidioides posadasii (strain C735) GN=ARG PE=3 SV=2 163 362 5.0E-16
sp|Q8K9C5|SYK_BUCAP Lysine--tRNA ligase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=lysS PE=3 SV=1 550 974 5.0E-16
sp|A8GIP4|SYK_SERP5 Lysine--tRNA ligase OS=Serratia proteamaculans (strain 568) GN=lysS PE=3 SV=1 543 974 9.0E-16
sp|Q5WVS0|SYK_LEGPL Lysine--tRNA ligase OS=Legionella pneumophila (strain Lens) GN=lysS PE=3 SV=1 551 974 2.0E-15
sp|P33280|ARGI_NEUCR Arginase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=aga-1 PE=1 SV=3 69 345 2.0E-15
sp|Q7VZ37|SYK_BORPE Lysine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=lysS PE=3 SV=1 555 974 2.0E-15
sp|Q12611|ARGI_EMENI Arginase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=agaA PE=3 SV=2 165 351 3.0E-15
sp|O08691|ARGI2_MOUSE Arginase-2, mitochondrial OS=Mus musculus GN=Arg2 PE=1 SV=1 58 390 3.0E-15
sp|O08701|ARGI2_RAT Arginase-2, mitochondrial OS=Rattus norvegicus GN=Arg2 PE=2 SV=1 58 390 3.0E-15
sp|Q58DL1|ARGI2_BOVIN Arginase-2, mitochondrial OS=Bos taurus GN=ARG2 PE=2 SV=1 70 384 4.0E-15
sp|Q5X4D5|SYK_LEGPA Lysine--tRNA ligase OS=Legionella pneumophila (strain Paris) GN=lysS PE=3 SV=1 551 974 5.0E-15
sp|Q32BV3|SYK_SHIDS Lysine--tRNA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=lysS PE=3 SV=1 555 974 5.0E-15
sp|P72703|SPEB1_SYNY3 Agmatinase 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=speB1 PE=3 SV=1 70 366 5.0E-15
sp|Q5ZUL6|SYK_LEGPH Lysine--tRNA ligase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=lysS PE=3 SV=1 551 974 6.0E-15
sp|A5ICT2|SYK_LEGPC Lysine--tRNA ligase OS=Legionella pneumophila (strain Corby) GN=lysS PE=3 SV=1 551 974 6.0E-15
sp|Q7WK46|SYK_BORBR Lysine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=lysS PE=3 SV=1 555 974 7.0E-15
sp|P0A8N3|SYK1_ECOLI Lysine--tRNA ligase OS=Escherichia coli (strain K12) GN=lysS PE=1 SV=2 555 974 8.0E-15
sp|P0A8N4|SYK1_ECOL6 Lysine--tRNA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=lysS PE=3 SV=2 555 974 8.0E-15
sp|B2VF45|SYK_ERWT9 Lysine--tRNA ligase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=lysS PE=3 SV=1 552 974 8.0E-15
sp|Q0T106|SYK_SHIF8 Lysine--tRNA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=lysS PE=3 SV=1 555 974 9.0E-15
sp|B2U0Q7|SYK_SHIB3 Lysine--tRNA ligase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=lysS PE=3 SV=1 555 974 9.0E-15
sp|Q83JU6|SYK1_SHIFL Lysine--tRNA ligase OS=Shigella flexneri GN=lysS PE=3 SV=3 555 974 9.0E-15
sp|Q31WF2|SYK_SHIBS Lysine--tRNA ligase OS=Shigella boydii serotype 4 (strain Sb227) GN=lysS PE=3 SV=1 555 974 1.0E-14
sp|Q6D945|SYK_PECAS Lysine--tRNA ligase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=lysS PE=3 SV=1 552 974 1.0E-14
sp|Q91553|ARGN1_XENLA Arginase, non-hepatic 1 OS=Xenopus laevis GN=arg2-a PE=2 SV=1 70 389 1.0E-14
sp|Q8XD57|SYK1_ECO57 Lysine--tRNA ligase OS=Escherichia coli O157:H7 GN=lysS PE=3 SV=3 555 974 1.0E-14
sp|P78540|ARGI2_HUMAN Arginase-2, mitochondrial OS=Homo sapiens GN=ARG2 PE=1 SV=1 70 390 1.0E-14
sp|Q91554|ARGN2_XENLA Arginase, non-hepatic 2 OS=Xenopus laevis GN=arg2-b PE=2 SV=1 70 389 1.0E-14
sp|Q7W8T6|SYK_BORPA Lysine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=lysS PE=3 SV=1 555 974 2.0E-14
sp|A9IQY2|SYK_BORPD Lysine--tRNA ligase OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=lysS PE=3 SV=1 552 976 2.0E-14
sp|Q1LTU4|SYK_BAUCH Lysine--tRNA ligase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=lysS PE=3 SV=1 500 974 3.0E-14
sp|Q91555|ARGN3_XENLA Arginase, non-hepatic 3 OS=Xenopus laevis GN=arg2-c PE=2 SV=1 70 389 5.0E-14
sp|Q6GER3|ARGI_STAAR Arginase OS=Staphylococcus aureus (strain MRSA252) GN=arg PE=3 SV=1 70 345 6.0E-14
sp|Q2NRG1|SYK_SODGM Lysine--tRNA ligase OS=Sodalis glossinidius (strain morsitans) GN=lysS PE=3 SV=1 555 974 7.0E-14
sp|A8AP96|SYK_CITK8 Lysine--tRNA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=lysS PE=3 SV=1 555 974 1.0E-13
sp|Q9KBE3|HUTG_BACHD Formimidoylglutamase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=hutG PE=3 SV=1 70 362 2.0E-13
sp|Q10066|ARGI2_SCHPO Arginase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=aru1 PE=3 SV=1 135 380 2.0E-13
sp|B7ID87|SYK_THEAB Lysine--tRNA ligase OS=Thermosipho africanus (strain TCF52B) GN=lysS PE=3 SV=1 544 974 3.0E-13
sp|Q9X231|SYK_THEMA Lysine--tRNA ligase OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=lysS PE=3 SV=1 508 974 3.0E-13
sp|A7MR65|SYK_CROS8 Lysine--tRNA ligase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=lysS PE=3 SV=1 555 974 3.0E-13
sp|P42068|HUTG_BACSU Formimidoylglutamase OS=Bacillus subtilis (strain 168) GN=hutG PE=1 SV=1 71 369 4.0E-13
sp|A1JPL4|SYK_YERE8 Lysine--tRNA ligase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=lysS PE=3 SV=1 490 974 4.0E-13
sp|Q7N1C8|SYK_PHOLL Lysine--tRNA ligase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=lysS PE=3 SV=1 555 974 4.0E-13
sp|B2JIY1|SYK_BURP8 Lysine--tRNA ligase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=lysS PE=3 SV=1 546 974 5.0E-13
sp|A5ILE6|SYK_THEP1 Lysine--tRNA ligase OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=lysS PE=3 SV=1 508 974 5.0E-13
sp|A9MRI4|SYK_SALAR Lysine--tRNA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=lysS PE=3 SV=1 555 974 5.0E-13
sp|C6D8Z6|SYK_PECCP Lysine--tRNA ligase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=lysS PE=3 SV=1 557 974 5.0E-13
sp|B1LAX6|SYK_THESQ Lysine--tRNA ligase OS=Thermotoga sp. (strain RQ2) GN=lysS PE=3 SV=1 508 974 6.0E-13
sp|B4EDB2|SYK_BURCJ Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=lysS PE=3 SV=1 555 974 6.0E-13
sp|B4F0M6|SYK_PROMH Lysine--tRNA ligase OS=Proteus mirabilis (strain HI4320) GN=lysS PE=3 SV=1 555 974 6.0E-13
sp|Q7VRF5|SYK_BLOFL Lysine--tRNA ligase OS=Blochmannia floridanus GN=lysS PE=3 SV=1 552 974 8.0E-13
sp|A0K8P2|SYK_BURCH Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain HI2424) GN=lysS PE=3 SV=1 555 974 8.0E-13
sp|B1JUZ7|SYK_BURCC Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain MC0-3) GN=lysS PE=3 SV=1 555 974 8.0E-13
sp|Q1BHT1|SYK_BURCA Lysine--tRNA ligase OS=Burkholderia cenocepacia (strain AU 1054) GN=lysS PE=3 SV=1 555 974 8.0E-13
sp|B8GRJ2|SYK_THISH Lysine--tRNA ligase OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=lysS PE=3 SV=1 554 974 8.0E-13
sp|A4WE42|SYK_ENT38 Lysine--tRNA ligase OS=Enterobacter sp. (strain 638) GN=lysS PE=3 SV=1 555 974 9.0E-13
sp|C5BAR6|SYK_EDWI9 Lysine--tRNA ligase OS=Edwardsiella ictaluri (strain 93-146) GN=lysS PE=3 SV=1 539 974 1.0E-12
sp|A6LMS4|SYK_THEM4 Lysine--tRNA ligase OS=Thermosipho melanesiensis (strain DSM 12029 / CIP 104789 / BI429) GN=lysS PE=3 SV=1 508 974 1.0E-12
sp|P37818|ARGI1_SCHPO Arginase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=car1 PE=3 SV=1 70 380 1.0E-12
sp|Q03E09|SYK_PEDPA Lysine--tRNA ligase OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=lysS PE=3 SV=1 696 974 1.0E-12
sp|O87821|SYK_RHIME Lysine--tRNA ligase OS=Rhizobium meliloti (strain 1021) GN=lysS PE=3 SV=2 548 974 2.0E-12
sp|Q3JQP3|SYK_BURP1 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1710b) GN=lysS PE=3 SV=1 551 974 3.0E-12
sp|Q63SN9|SYK_BURPS Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain K96243) GN=lysS PE=3 SV=1 551 974 3.0E-12
sp|A3NB96|SYK_BURP6 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 668) GN=lysS PE=3 SV=1 551 974 3.0E-12
sp|Q4VK78|ARGI2_RABIT Arginase-2, mitochondrial OS=Oryctolagus cuniculus GN=ARG2 PE=2 SV=1 70 386 3.0E-12
sp|A3NX27|SYK_BURP0 Lysine--tRNA ligase OS=Burkholderia pseudomallei (strain 1106a) GN=lysS PE=3 SV=1 551 974 3.0E-12
sp|A1V5L6|SYK_BURMS Lysine--tRNA ligase OS=Burkholderia mallei (strain SAVP1) GN=lysS PE=3 SV=1 551 974 3.0E-12
sp|Q62IZ9|SYK_BURMA Lysine--tRNA ligase OS=Burkholderia mallei (strain ATCC 23344) GN=lysS PE=3 SV=1 551 974 3.0E-12
sp|A2SAT3|SYK_BURM9 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10229) GN=lysS PE=3 SV=1 551 974 3.0E-12
sp|A3ML91|SYK_BURM7 Lysine--tRNA ligase OS=Burkholderia mallei (strain NCTC 10247) GN=lysS PE=3 SV=1 551 974 3.0E-12
sp|A0L6F7|SYK_MAGMM Lysine--tRNA ligase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=lysS PE=3 SV=1 501 975 4.0E-12
sp|Q9SSK1|SYNC3_ARATH Asparagine--tRNA ligase, cytoplasmic 3 OS=Arabidopsis thaliana GN=SYNC3 PE=1 SV=1 544 718 3.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0006418 tRNA aminoacylation for protein translation Yes
GO:0000166 nucleotide binding Yes
GO:0003676 nucleic acid binding Yes
GO:0005524 ATP binding Yes
GO:0004812 aminoacyl-tRNA ligase activity Yes
GO:0006725 cellular aromatic compound metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0043436 oxoacid metabolic process No
GO:0140101 catalytic activity, acting on a tRNA No
GO:0140098 catalytic activity, acting on RNA No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0032559 adenyl ribonucleotide binding No
GO:0043170 macromolecule metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0030554 adenyl nucleotide binding No
GO:0006082 organic acid metabolic process No
GO:0019752 carboxylic acid metabolic process No
GO:0043038 amino acid activation No
GO:0008152 metabolic process No
GO:0140640 catalytic activity, acting on a nucleic acid No
GO:0009987 cellular process No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0032555 purine ribonucleotide binding No
GO:0044237 cellular metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0016875 ligase activity, forming carbon-oxygen bonds No
GO:0006807 nitrogen compound metabolic process No
GO:0006399 tRNA metabolic process No
GO:0016070 RNA metabolic process No
GO:0016874 ligase activity No
GO:0071704 organic substance metabolic process No
GO:0044281 small molecule metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043169 cation binding No
GO:0044238 primary metabolic process No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0043168 anion binding No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0043039 tRNA aminoacylation No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006520 cellular amino acid metabolic process No
GO:0003674 molecular_function No
GO:0034660 ncRNA metabolic process No
GO:0032553 ribonucleotide binding No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.99956

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4332
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6271
Ophiocordyceps australis map64 (Brazil) OphauB2|6938
Ophiocordyceps camponoti-floridani Ophcf2|01880
Ophiocordyceps camponoti-rufipedis Ophun1|6567 (this protein)
Ophiocordyceps kimflemingae Ophio5|4050
Ophiocordyceps subramaniannii Hirsu2|89

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6567
MKSAVALVGLLASSVCSAHGADDHGGPWSKEALAELEAKWGYEWGFSGIGSFAHLDHVKCLVDPSVQFDIAVIGV
PFDTAVSFRPGARFGPRAIRHSSARQTAFRGFNPRAGINPYQDWAKIIDCGDMPITPFDNQIALEQMTQAFRELG
KRKASKTSNPRPRLVTLGGDHSLALPALRALKEIYGRPVRVLHFDAHLDTWDPYSYPAAWGATQFTHGSMFWMAS
QEGLLSNSSSSPSVHAGLRTRLSGTSWADNESDGSQNWVRFSADDMDEKGTSGIIDGIVKTLGTEDPVYLSVDID
VLDPAFAPGTGTPEPGGWTTRELIRVLRGIEGLNLVGADVVEVSPAYQGRGEETALAAAQVVYEMVTSMVKRGSK
GQAVVRDELTPLEPEFRYIFSEMAAVQELAERIRSDDSVYVDTDAGVDDGTADGSQGKPFKSLAFAYIQNIDRPG
VTYLTRASVTGSEEDAAARMAWKAPAKSAVKKAQGAVDVHKKKLAKQQQVQASEDAKKQQRLGNLEASKKIIIRE
DPSLPKAVKMNIGDKTVALGDGDGVKGARVKVSGRIHRLRVQKQATFITLVDGRGHLQCVLQAGDLTKTYDALLF
AQGTSLTLHGEMRKVPDGQTAPDGRELHVDYYTVIGTSPGDEEAITNKVSSTQNQWDQLMLDNRHLVLRGDNASA
VMKLRASVEWAFIKAYHDMGFVKVSPPALVQTQVEGGATLFNVPYYDELAYLTQSSQLYLETVLPSLGNVYCIEK
SFRAEKSLTRRHLSEYTHVEAELDFIEFGEMLEHIEEVICRVVDSVLEDAEMARLLKELNPGFDRPSRPFLRMKY
SDAIDWLNKQDPPILNEEGNTHVFGDDIAEAAERKMTDIINRPIFLTHFPVEIKAFYMKKDPSDVRVTESVDCLM
PGVGEIVGGSMRMEGYDELLAAYEKQGIPAKDYYWYTDQRKYGTSPHGGYGLGLERFLAWMANQHTVRTTCLYPR
FMGRCKP*
Coding >Ophun1|6567
ATGAAGTCGGCTGTCGCTCTCGTTGGCTTGCTTGCCTCGTCTGTGTGCTCTGCTCACGGGGCGGATGACCATGGC
GGGCCGTGGTCAAAGGAGGCGCTCGCTGAGCTTGAGGCGAAATGGGGATACGAGTGGGGATTCTCGGGGATCGGA
TCGTTTGCGCACCTCGATCACGTCAAATGCCTCGTCGACCCTTCGGTGCAGTTCGATATCGCCGTCATCGGCGTG
CCTTTCGATACGGCCGTCAGCTTTCGACCGGGCGCCCGGTTCGGACCCCGGGCCATCCGGCACTCGTCGGCTCGG
CAGACGGCCTTTCGCGGCTTCAACCCCCGGGCCGGAATCAACCCGTACCAGGACTGGGCCAAGATCATCGACTGC
GGAGACATGCCCATCACGCCATTCGATAATCAGATTGCGCTGGAGCAGATGACGCAGGCGTTTCGTGAGCTGGGG
AAGAGGAAGGCGTCCAAGACGTCGAACCCTAGGCCGCGGCTGGTGACGCTGGGAGGAGATCATAGCCTGGCGCTT
CCGGCGCTGCGAGCTCTCAAGGAGATTTATGGGCGGCCGGTGCGGGTTCTGCACTTTGATGCGCATCTCGATACC
TGGGATCCTTACTCGTATCCGGCTGCCTGGGGCGCGACGCAGTTCACTCACGGGTCCATGTTCTGGATGGCGAGC
CAGGAGGGCCTGCTATCCAACTCATCGTCGTCGCCCTCGGTGCACGCGGGTCTACGAACGCGGCTCAGCGGCACA
TCGTGGGCCGACAACGAATCAGACGGGTCACAGAACTGGGTGCGCTTCTCGGCCGACGACATGGACGAAAAGGGC
ACGTCGGGCATCATCGACGGCATCGTGAAGACGCTGGGGACTGAAGACCCCGTCTACCTATCCGTCGACATTGAC
GTGCTGGATCCGGCGTTTGCGCCGGGCACGGGGACGCCTGAACCGGGGGGCTGGACGACGCGAGAGCTGATTCGC
GTCCTTCGTGGCATTGAGGGCCTGAATCTCGTGGGGGCTGACGTCGTGGAGGTGTCGCCGGCTTATCAGGGGCGT
GGCGAGGAGACGGCTCTGGCGGCGGCTCAGGTTGTCTATGAGATGGTGACGTCGATGGTGAAGCGTGGTAGTAAG
GGGCAGGCGGTTGTCAGGGATGAGCTCACACCTCTCGAGCCCGAGTTTCGGTATATCTTTTCGGAAATGGCAGCC
GTGCAGGAGCTCGCAGAGCGGATCCGAAGCGACGACTCCGTCTACGTCGACACGGACGCGGGCGTCGACGATGGA
ACTGCTGATGGTTCCCAAGGAAAGCCTTTCAAGTCGCTGGCCTTTGCCTACATCCAGAACATAGATCGTCCGGGC
GTCACGTATCTCACGCGCGCCTCCGTCACCGGCTCTGAGGAGGATGCCGCTGCCAGGATGGCCTGGAAGGCTCCC
GCCAAAAGCGCTGTCAAGAAGGCTCAGGGCGCCGTCGACGTCCATAAGAAGAAACTGGCCAAGCAGCAGCAAGTT
CAGGCCTCGGAGGATGCCAAGAAGCAGCAGCGTCTGGGAAATCTCGAGGCGTCTAAAAAGATCATCATCCGCGAA
GATCCGTCCTTGCCCAAGGCCGTCAAGATGAACATTGGCGATAAGACGGTTGCGCTCGGCGACGGCGACGGCGTC
AAGGGCGCCAGGGTCAAGGTGTCGGGACGAATTCACCGATTGAGGGTCCAGAAGCAGGCCACCTTCATCACCTTG
GTCGACGGCCGTGGTCACCTGCAGTGCGTCTTGCAGGCTGGCGACTTGACCAAGACTTACGACGCTCTGCTCTTC
GCGCAAGGAACGTCTCTCACGCTGCATGGCGAGATGCGAAAAGTTCCGGACGGACAGACGGCGCCGGACGGTCGT
GAGCTGCACGTCGACTACTACACCGTCATCGGAACCTCGCCCGGGGACGAAGAGGCCATTACCAACAAGGTGTCG
TCGACGCAGAACCAGTGGGACCAGCTGATGCTCGACAACCGACACTTGGTTCTTCGGGGCGACAACGCGTCGGCC
GTCATGAAGCTGCGGGCCAGCGTCGAATGGGCCTTCATCAAGGCCTACCACGACATGGGATTCGTCAAAGTGTCG
CCCCCTGCCCTGGTGCAGACGCAAGTCGAGGGCGGCGCCACGCTCTTCAACGTGCCCTATTACGACGAGCTGGCC
TACCTCACCCAGTCGTCGCAGCTCTACCTCGAGACGGTCCTCCCCAGTCTCGGCAACGTCTACTGCATCGAGAAG
TCGTTCCGCGCCGAAAAGAGCCTCACCAGACGGCACCTGTCGGAATACACGCACGTCGAGGCTGAGCTCGACTTT
ATCGAGTTTGGCGAAATGCTGGAGCACATTGAGGAAGTCATCTGTCGCGTGGTCGATTCGGTTCTCGAGGATGCC
GAAATGGCGCGCCTGCTCAAGGAGCTCAACCCCGGCTTCGACCGGCCGTCGCGGCCTTTCCTGCGGATGAAGTAC
TCGGACGCCATTGATTGGCTCAACAAGCAGGATCCCCCGATCCTCAACGAAGAAGGCAACACGCACGTGTTTGGT
GACGACATCGCCGAGGCGGCGGAGCGCAAGATGACGGACATTATCAACCGCCCCATCTTCCTGACGCACTTTCCG
GTCGAGATCAAGGCCTTTTACATGAAGAAGGACCCCAGCGATGTTCGGGTGACGGAAAGCGTCGATTGTCTGATG
CCGGGCGTGGGCGAGATTGTGGGAGGGTCCATGAGGATGGAAGGCTACGACGAGCTGCTGGCCGCGTACGAGAAG
CAGGGGATACCGGCCAAGGACTACTACTGGTACACGGATCAGCGAAAGTATGGCACGTCGCCTCACGGCGGCTAC
GGCCTGGGCCTGGAGCGGTTCCTGGCGTGGATGGCCAACCAGCACACGGTGCGGACGACTTGCCTGTATCCGCGG
TTCATGGGTCGCTGCAAGCCTTGA
Transcript >Ophun1|6567
ATGAAGTCGGCTGTCGCTCTCGTTGGCTTGCTTGCCTCGTCTGTGTGCTCTGCTCACGGGGCGGATGACCATGGC
GGGCCGTGGTCAAAGGAGGCGCTCGCTGAGCTTGAGGCGAAATGGGGATACGAGTGGGGATTCTCGGGGATCGGA
TCGTTTGCGCACCTCGATCACGTCAAATGCCTCGTCGACCCTTCGGTGCAGTTCGATATCGCCGTCATCGGCGTG
CCTTTCGATACGGCCGTCAGCTTTCGACCGGGCGCCCGGTTCGGACCCCGGGCCATCCGGCACTCGTCGGCTCGG
CAGACGGCCTTTCGCGGCTTCAACCCCCGGGCCGGAATCAACCCGTACCAGGACTGGGCCAAGATCATCGACTGC
GGAGACATGCCCATCACGCCATTCGATAATCAGATTGCGCTGGAGCAGATGACGCAGGCGTTTCGTGAGCTGGGG
AAGAGGAAGGCGTCCAAGACGTCGAACCCTAGGCCGCGGCTGGTGACGCTGGGAGGAGATCATAGCCTGGCGCTT
CCGGCGCTGCGAGCTCTCAAGGAGATTTATGGGCGGCCGGTGCGGGTTCTGCACTTTGATGCGCATCTCGATACC
TGGGATCCTTACTCGTATCCGGCTGCCTGGGGCGCGACGCAGTTCACTCACGGGTCCATGTTCTGGATGGCGAGC
CAGGAGGGCCTGCTATCCAACTCATCGTCGTCGCCCTCGGTGCACGCGGGTCTACGAACGCGGCTCAGCGGCACA
TCGTGGGCCGACAACGAATCAGACGGGTCACAGAACTGGGTGCGCTTCTCGGCCGACGACATGGACGAAAAGGGC
ACGTCGGGCATCATCGACGGCATCGTGAAGACGCTGGGGACTGAAGACCCCGTCTACCTATCCGTCGACATTGAC
GTGCTGGATCCGGCGTTTGCGCCGGGCACGGGGACGCCTGAACCGGGGGGCTGGACGACGCGAGAGCTGATTCGC
GTCCTTCGTGGCATTGAGGGCCTGAATCTCGTGGGGGCTGACGTCGTGGAGGTGTCGCCGGCTTATCAGGGGCGT
GGCGAGGAGACGGCTCTGGCGGCGGCTCAGGTTGTCTATGAGATGGTGACGTCGATGGTGAAGCGTGGTAGTAAG
GGGCAGGCGGTTGTCAGGGATGAGCTCACACCTCTCGAGCCCGAGTTTCGGTATATCTTTTCGGAAATGGCAGCC
GTGCAGGAGCTCGCAGAGCGGATCCGAAGCGACGACTCCGTCTACGTCGACACGGACGCGGGCGTCGACGATGGA
ACTGCTGATGGTTCCCAAGGAAAGCCTTTCAAGTCGCTGGCCTTTGCCTACATCCAGAACATAGATCGTCCGGGC
GTCACGTATCTCACGCGCGCCTCCGTCACCGGCTCTGAGGAGGATGCCGCTGCCAGGATGGCCTGGAAGGCTCCC
GCCAAAAGCGCTGTCAAGAAGGCTCAGGGCGCCGTCGACGTCCATAAGAAGAAACTGGCCAAGCAGCAGCAAGTT
CAGGCCTCGGAGGATGCCAAGAAGCAGCAGCGTCTGGGAAATCTCGAGGCGTCTAAAAAGATCATCATCCGCGAA
GATCCGTCCTTGCCCAAGGCCGTCAAGATGAACATTGGCGATAAGACGGTTGCGCTCGGCGACGGCGACGGCGTC
AAGGGCGCCAGGGTCAAGGTGTCGGGACGAATTCACCGATTGAGGGTCCAGAAGCAGGCCACCTTCATCACCTTG
GTCGACGGCCGTGGTCACCTGCAGTGCGTCTTGCAGGCTGGCGACTTGACCAAGACTTACGACGCTCTGCTCTTC
GCGCAAGGAACGTCTCTCACGCTGCATGGCGAGATGCGAAAAGTTCCGGACGGACAGACGGCGCCGGACGGTCGT
GAGCTGCACGTCGACTACTACACCGTCATCGGAACCTCGCCCGGGGACGAAGAGGCCATTACCAACAAGGTGTCG
TCGACGCAGAACCAGTGGGACCAGCTGATGCTCGACAACCGACACTTGGTTCTTCGGGGCGACAACGCGTCGGCC
GTCATGAAGCTGCGGGCCAGCGTCGAATGGGCCTTCATCAAGGCCTACCACGACATGGGATTCGTCAAAGTGTCG
CCCCCTGCCCTGGTGCAGACGCAAGTCGAGGGCGGCGCCACGCTCTTCAACGTGCCCTATTACGACGAGCTGGCC
TACCTCACCCAGTCGTCGCAGCTCTACCTCGAGACGGTCCTCCCCAGTCTCGGCAACGTCTACTGCATCGAGAAG
TCGTTCCGCGCCGAAAAGAGCCTCACCAGACGGCACCTGTCGGAATACACGCACGTCGAGGCTGAGCTCGACTTT
ATCGAGTTTGGCGAAATGCTGGAGCACATTGAGGAAGTCATCTGTCGCGTGGTCGATTCGGTTCTCGAGGATGCC
GAAATGGCGCGCCTGCTCAAGGAGCTCAACCCCGGCTTCGACCGGCCGTCGCGGCCTTTCCTGCGGATGAAGTAC
TCGGACGCCATTGATTGGCTCAACAAGCAGGATCCCCCGATCCTCAACGAAGAAGGCAACACGCACGTGTTTGGT
GACGACATCGCCGAGGCGGCGGAGCGCAAGATGACGGACATTATCAACCGCCCCATCTTCCTGACGCACTTTCCG
GTCGAGATCAAGGCCTTTTACATGAAGAAGGACCCCAGCGATGTTCGGGTGACGGAAAGCGTCGATTGTCTGATG
CCGGGCGTGGGCGAGATTGTGGGAGGGTCCATGAGGATGGAAGGCTACGACGAGCTGCTGGCCGCGTACGAGAAG
CAGGGGATACCGGCCAAGGACTACTACTGGTACACGGATCAGCGAAAGTATGGCACGTCGCCTCACGGCGGCTAC
GGCCTGGGCCTGGAGCGGTTCCTGGCGTGGATGGCCAACCAGCACACGGTGCGGACGACTTGCCTGTATCCGCGG
TTCATGGGTCGCTGCAAGCCTTGA
Gene >Ophun1|6567
ATGAAGTCGGCTGTCGCTCTCGTTGGCTTGCTTGCCTCGTCTGTGTGCTCTGCTCACGGGGCGGATGACCATGGC
GGGCCGTGGTCAAAGGAGGCGCTCGCTGAGCTTGAGGCGAAATGGGGATACGAGGTGGGTGGCAGGCGATGTGCC
GTTGTGGACGACGGCTTGCTGATGACGATGGTGATGGTGTCTTCAGTGGGGATTCTCGGGGATCGGATCGTTTGC
GCACCTCGATCACGTCAAATGCCTCGTCGACCCTTCGGTGCAGTTCGATATCGCCGTCATCGGCGTGCCTTTCGA
TACGGCCGTCAGCTTTCGACCGGGTTTGTACCCTCGTGAATGCTGAGGATAGTGGACAGTGGTGCAGCAGCTGAC
AAGGGCTTCATCCAGGCGCCCGGTTCGGACCCCGGGCCATCCGGCACTCGTCGGCTCGGCAGACGGCCTTTCGCG
GCTTCAACCCCCGGGCCGGAATCAACCCGTACCAGGACTGGGCCAAGATCATCGACTGCGGAGACATGCCCATCA
CGCCATTCGATAATCAGATTGCGCTGGAGCAGATGACGCAGGCGTTTCGTGAGCTGGGGAAGAGGAAGGCGTCCA
AGACGTCGAACCCTAGGCCGCGGCTGGTGACGCTGGGAGGAGATCATAGCCTGGCGCTTCCGGCGCTGCGAGCTC
TCAAGGAGATTTATGGGCGGCCGGTGCGGGTTCTGCACTTTGATGGTGAGCAAGCGGAGAGAAAGGGCGCCCTAT
CTCTACTGATAGACTGACGAGGAACAGCGCATCTCGATACCTGGGATCCTTACTCGTATCCGGCTGCCTGGGGCG
CGACGCAGTTCACTCACGGGTCCATGTTCTGGATGGCGAGCCAGGAGGGCCTGCTATCCAACTCATCGTCGTCGC
CCTCGGTGCACGCGGGTCTACGAACGCGGCTCAGCGGCACATCGTGGGCCGACAACGAATCAGACGGGTCACAGA
ACTGGGTGCGCTTCTCGGCCGACGACATGGACGAAAAGGGCACGTCGGGCATCATCGACGGCATCGTGAAGACGC
TGGGGACTGAAGACCCCGTCTACCTATCCGTCGACATTGACGTGCTGGATCCGGCGTTTGCGCCGGGCACGGGGA
CGCCTGAACCGGGGGGCTGGACGACGCGAGAGCTGATTCGCGTCCTTCGTGGCATTGAGGGCCTGAATCTCGTGG
GGGCTGACGTCGTGGAGGTGTCGCCGGCTTATCAGGGGCGTGGCGAGGAGACGGCTCTGGCGGCGGCTCAGGTTG
TCTATGAGATGGTGACGTCGATGGTGAAGCGTGGTAGTAAGGGGCAGGCGGTTGTCAGGGATGAGCTGTAGGGAG
CTAGATGTTGGTGATGGACGCTGTTGTTCTCAGGCTTCAGCTCCGAATATCGCTTCACTGACTCACTCGTCGGCT
GATAGTCAAACAGTGCTGCCGTTGGAAATCGCACAGTCGTACCCCGCCATCCCACCTTCTGTGAGACAGCTCGCG
AAATAAATCCACACAGCATCTCGTCTCTTCCTTCATCGTCTGTTCTCTCTCCTCTCACTCATCAGCACACCTCTC
GAGCCCGAGTTTCGGTATATCTTTTCGGAAATGGCAGCCGTGCAGGAGCTCGCAGAGCGGATCCGAAGCGACGAC
TCCGTCTACGTCGACACGGACGCGGGCGTCGACGATGGAACTGCTGATGGTTCCCAAGGAAAGCCTTTCAAGTCG
CTGGCCTTTGCCTACATCCAGAACATAGATCGTCCGGGCGTCACGTATCTCACGCGCGCCTCCGTCACCGGCTCT
GAGGAGGATGCCGCTGCCAGGATGGCCTGGAAGGCTCCCGCCAAAAGCGCTGTCAAGAAGGCTCAGGGCGCCGTC
GACGTCCATAAGAAGAAACTGGCCAAGCAGCAGCAAGTTCAGGCCTCGGAGGATGCCAAGAAGCAGCAGCGTCTG
GGAAATCTCGAGGCGTCTAAAAAGATCATCATCCGCGAAGATCCGTCCTTGCCCAAGGCCGTCAAGATGAACATT
GGCGATAAGACGGTTGCGCTCGGCGACGGCGACGGCGTCAAGGGCGCCAGGGTCAAGGTGTCGGGACGAATTCAC
CGATTGAGGGTCCAGAAGCAGGCCACCTTCATCACCTTGGTCGACGGCCGTGGTCACCTGCAGTGCGTCTTGCAG
GCTGGCGACTTGACCAAGACTTACGACGCTCTGCTCTTCGCGCAAGGAACGTCTCTCACGCTGCATGGCGAGATG
CGAAAAGTTCCGGACGGACAGACGGCGCCGGACGGTCGTGAGCTGCACGTCGACTACTACACCGTCATCGGAACC
TCGCCCGGGGACGAAGAGGCCATTACCAACAAGGTGTCGTCGACGCAGAACCAGTGGGACCAGCTGATGCTCGAC
AACCGACACTTGGTTCTTCGGGGCGACAACGCGTCGGCCGTCATGAAGCTGCGGGCCAGCGTCGAATGGGCCTTC
ATCAAGGCCTACCACGACATGGGATTCGTCAAAGTGTCGCCCCCTGCCCTGGTGCAGACGCAAGTCGAGGGCGGC
GCCACGCTCTTCAACGTGCCCTATTACGACGAGCTGGCCTACCTCACCCAGTCGTCGCAGCTCTACCTCGAGACG
GTCCTCCCCAGTCTCGGCAACGTCTACTGCATCGAGAAGTCGTTCCGCGCCGAAAAGAGCCTCACCAGACGGCAC
CTGTCGGAATACACGCACGTCGAGGCTGAGCTCGACTTTATCGAGTTTGGCGAAATGCTGGAGCACATTGAGGAA
GTCATCTGTCGCGTGGTCGATTCGGTTCTCGAGGATGCCGAAATGGCGCGCCTGCTCAAGGAGCTCAACCCCGGC
TTCGACCGGCCGTCGCGGCCTTTCCTGCGGATGAAGTACTCGGACGCCATTGATTGGCTCAACAAGCAGGATCCC
CCGATCCTCAACGAAGAAGGCAACACGCACGTGTTTGGTGACGACATCGCCGAGGCGGCGGAGCGCAAGATGACG
GACATTATCAACCGCCCCATCTTCCTGACGCACTTTCCGGTCGAGATCAAGGCCTTTTACATGAAGAAGGACCCC
AGCGATGTTCGGGTGACGGAAAGCGTCGATTGTCTGATGCCGGGCGTGGGCGAGATTGTGGGAGGGTCCATGAGG
ATGGAAGGCTACGACGAGCTGCTGGCCGCGTACGAGAAGCAGGGGATACCGGCCAAGGACTACTACTGGTACACG
GATCAGCGAAAGTGAGTTTGCGTATCGAGACGGGGCAGACGAAGGACGTGGCTAACTTTTGGGGCAACAGGTATG
GCACGTCGCCTCACGGCGGCTACGGCCTGGGCCTGGAGCGGTTCCTGGCGTGGATGGCCAACCAGCACACGGTGC
GGACGACTTGCCTGTATCCGCGGTTCATGGGTCGCTGCAAGCCTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail