Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6561
Gene name
LocationContig_725:4375..7810
Strand-
Gene length (bp)3435
Transcript length (bp)3105
Coding sequence length (bp)3105
Protein length (aa) 1035

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF10537 WAC_Acf1_DNA_bd ATP-utilising chromatin assembly and remodelling N-terminal 7.1E-37 45 145
PF02791 DDT DDT domain 1.5E-15 406 463
PF15613 WSD Williams-Beuren syndrome DDT (WSD), D-TOX E motif 1.9E-15 801 926
PF15612 WHIM1 WSTF, HB1, Itc1p, MBD9 motif 1 9.8E-08 607 640

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 44 438 3.0E-31
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 548 896 3.0E-11
sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex subunit YPL216W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL216W PE=1 SV=1 24 250 1.0E-08
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 25 156 4.0E-08
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 25 156 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 44 438 3.0E-31
sp|P53125|ITC1_YEAST Imitation switch two complex protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ITC1 PE=1 SV=1 548 896 3.0E-11
sp|Q08964|YP216_YEAST Putative ISWI chromatin-remodeling complex subunit YPL216W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YPL216W PE=1 SV=1 24 250 1.0E-08
sp|O88379|BAZ1A_MOUSE Bromodomain adjacent to zinc finger domain protein 1A OS=Mus musculus GN=Baz1a PE=1 SV=3 25 156 4.0E-08
sp|Q9NRL2|BAZ1A_HUMAN Bromodomain adjacent to zinc finger domain protein 1A OS=Homo sapiens GN=BAZ1A PE=1 SV=2 25 156 5.0E-08
sp|Q54ST3|Y2237_DICDI DDT domain-containing protein DDB_G0282237 OS=Dictyostelium discoideum GN=DDB_G0282237 PE=3 SV=1 45 146 1.0E-06
sp|A8DZJ1|BAZ1B_XENLA Tyrosine-protein kinase BAZ1B OS=Xenopus laevis GN=baz1b PE=2 SV=2 25 149 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 14 0.45

Transmembrane Domains

(None)

Transcription Factor Class

Transcription Factor Class
(based on PFAM domains)
DDT

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6561
MVIAAVFSRPTRTALTLASLPIQVLFKRKPVKFLSPPDIDDDAAEVWHIAQTGEVFITYEDYLSRMEFYKQRRFN
DQITGHSGLTFFEAFTSELAGGREVDLSFPEALKGPILRKVQFQTISRLDNLVDMIYDEFKHDFYPGEEVTVTVD
GGDRVHGLVRDKTSFGPRILPDGSHAQPMTRYLVNIKDTEEETMVTDEHICRDRGTFTKSMLRSFIKKTVIREAW
TGAPWLVKHDYAAQHHIDTRVPPQLRYDTKVQERRQLQAQKRATPHDANANGATTAAATMNQGPVRLPELKPAPK
SHKGKQGSQGAKGLKWPPTMSLNGANGYGHHHHHHSAADSHRAAGLRDPPSPPSPPPPPPPKYPIDDLLLEPKQG
STRPRISFMCRDPPVDVGGRGTMHNRIDMASVGALLETWDTLNVYCEIFRLDSFTFDDFVEAMSVASDRVHVQLF
EEIHCAVLKILVESESDGGRVCIALPDLGDDAADGDAAVGLQSPDPTPEPEPKPTGRATRSSLAKLEAERLAAEA
AAAEEESLRAELASKHRAEELLKEYDWIEHLRKRDFAHGGWQRIIVGLLHQLSKKERREKACEELLLQLVPPNTN
PTQEAVRQTYARLDINYRVRALQILCMLTMETKAVRAYMEDCSEAMTKYRKDRIEWQRQRKQAMEDLRQLNEERK
ALMPDVTPPEYHPIKEEDVKMADDSLLDKDEDGEGDAGKSHKKRRSRGPTEKQRKREEERERKMRDKEKGRDGVK
GAKGTTKLPPQQQKQYNKLLKEIQKREDTIKECETEIGVIENDLREADCARTRVLGKDRFWNRYYWFERNGMPYG
GLPNSSTASAEYANGCIWVQGPDELERTGYIDVPADVENEYRARFDMTIAERKEREEDGTSVFNATQWGFICEPD
DVDRLIRWLDPRGLNELKLRKELLNYRDKMATHMERRKKYLSEAEAEAGTAKAADTGDKERRDEGTKRTSSRIRD
KTPETARYRCLRWENTMALETLGHLHAEQPPPPRPKKQSRKREAAGEAAGRGPAKTRRR*
Coding >Ophun1|6561
ATGGTAATCGCCGCTGTTTTTTCCCGTCCAACCCGGACCGCGCTCACTCTTGCTTCTCTGCCTATCCAGGTTCTC
TTCAAGCGGAAACCCGTCAAGTTTCTGTCGCCTCCGGATATTGACGATGACGCTGCAGAGGTCTGGCACATCGCC
CAGACCGGCGAGGTTTTCATCACCTACGAAGACTATCTGAGTCGCATGGAGTTTTACAAACAGCGCCGCTTCAAC
GACCAGATCACCGGTCACTCGGGCCTTACCTTTTTCGAGGCCTTTACCAGCGAGCTCGCCGGAGGCCGCGAGGTT
GACCTCAGCTTCCCAGAGGCTCTCAAAGGGCCCATCCTGCGCAAGGTTCAGTTCCAGACCATCTCCCGCCTCGAC
AACCTCGTCGACATGATATACGACGAGTTCAAGCACGACTTCTACCCCGGCGAGGAGGTCACCGTCACCGTCGAC
GGCGGCGATCGAGTCCACGGCCTGGTCCGCGACAAGACTTCGTTTGGGCCCCGCATCCTACCCGACGGCTCCCAC
GCACAGCCCATGACCCGCTACCTCGTCAACATCAAGGACACCGAGGAGGAGACCATGGTCACCGACGAGCACATC
TGCCGCGACCGTGGCACCTTCACAAAGTCGATGCTGAGGTCCTTTATTAAGAAGACGGTCATCCGGGAGGCCTGG
ACCGGCGCCCCGTGGCTCGTCAAACACGACTACGCCGCCCAGCACCACATCGACACCCGAGTGCCCCCCCAGCTC
CGCTACGATACAAAGGTCCAGGAGCGCCGACAGCTCCAGGCCCAGAAACGCGCCACCCCCCACGACGCCAACGCA
AACGGCGCCACCACCGCTGCCGCCACCATGAATCAGGGCCCCGTACGCCTGCCCGAGCTCAAGCCCGCGCCAAAG
AGCCACAAGGGCAAGCAGGGCTCCCAGGGCGCAAAGGGCCTCAAGTGGCCCCCTACCATGTCGCTCAACGGCGCC
AACGGCTACGGCCACCATCATCATCACCACTCCGCCGCCGACAGCCACCGCGCAGCCGGCCTGCGAGATCCGCCC
TCGCCGCCGTCGCCGCCGCCGCCGCCGCCGCCAAAGTATCCGATCGACGACCTCCTGCTCGAGCCTAAGCAAGGC
AGCACGCGGCCCCGAATCAGCTTCATGTGCAGGGACCCCCCCGTCGACGTCGGGGGCCGCGGGACCATGCACAAT
CGCATCGACATGGCATCCGTCGGCGCCCTCCTCGAGACGTGGGATACACTCAACGTCTACTGCGAAATCTTTCGT
CTCGACTCGTTCACCTTTGACGACTTTGTCGAGGCCATGTCGGTGGCCTCGGACCGCGTCCACGTGCAGCTGTTT
GAGGAGATACACTGCGCCGTCCTCAAGATCCTCGTCGAGTCCGAGTCCGACGGCGGCAGGGTCTGCATCGCCCTC
CCCGACTTGGGCGACGACGCCGCCGACGGAGACGCCGCCGTCGGGCTACAGAGCCCCGATCCCACGCCCGAGCCG
GAGCCGAAGCCGACGGGGCGCGCCACCCGCAGCAGCCTCGCCAAGCTCGAGGCCGAGCGGCTGGCGGCCGAGGCG
GCAGCGGCCGAAGAGGAGAGCCTCCGGGCTGAGCTCGCGTCCAAGCACCGGGCCGAGGAGCTCCTCAAGGAATAC
GACTGGATCGAGCACCTGCGCAAGCGCGACTTTGCCCACGGCGGCTGGCAGAGGATCATCGTCGGTCTGCTGCAC
CAGTTGTCCAAGAAGGAGCGCCGGGAGAAGGCGTGCGAGGAGCTGCTGCTGCAGCTGGTGCCGCCCAATACGAAC
CCGACGCAAGAGGCGGTGCGGCAGACGTACGCCAGGCTCGACATCAACTACCGCGTCCGGGCGCTGCAGATCCTC
TGCATGCTGACCATGGAGACCAAGGCAGTCAGGGCTTACATGGAGGACTGCAGCGAGGCCATGACCAAGTATCGC
AAGGACAGGATCGAGTGGCAGAGGCAGCGGAAGCAGGCGATGGAGGATCTTAGGCAGCTCAACGAGGAGCGAAAG
GCCTTGATGCCCGACGTGACGCCCCCCGAATATCATCCCATCAAGGAAGAAGACGTCAAGATGGCAGACGACTCT
CTCTTGGATAAGGACGAGGACGGAGAAGGTGACGCGGGCAAGTCGCACAAAAAGCGCCGAAGCCGTGGTCCGACG
GAGAAGCAGCGCAAGCGCGAAGAGGAGAGGGAACGAAAGATGCGAGACAAGGAAAAGGGGCGGGACGGCGTCAAG
GGTGCCAAGGGGACGACGAAGCTGCCGCCTCAGCAGCAGAAGCAGTACAACAAGCTGCTCAAGGAGATACAGAAG
CGCGAGGACACGATCAAGGAATGCGAGACGGAAATCGGCGTCATCGAAAACGATTTGCGCGAGGCCGACTGCGCC
AGGACGCGGGTCCTGGGCAAGGATCGCTTCTGGAACCGTTACTACTGGTTCGAACGCAACGGCATGCCCTACGGC
GGACTCCCCAACAGCTCGACGGCCTCTGCCGAGTACGCCAACGGCTGCATCTGGGTGCAGGGCCCGGACGAGCTG
GAGCGGACGGGCTACATCGACGTGCCGGCCGACGTGGAAAACGAGTACCGGGCGCGGTTCGACATGACGATAGCC
GAGCGCAAGGAGCGTGAGGAGGACGGGACGAGCGTCTTCAACGCGACGCAATGGGGCTTCATCTGCGAGCCCGAC
GACGTGGACCGACTGATCCGCTGGCTGGACCCGCGCGGCCTCAACGAGCTGAAGCTGCGCAAGGAGCTCCTCAAC
TACCGCGACAAGATGGCGACGCACATGGAGAGGCGCAAGAAGTACCTGTCGGAGGCCGAGGCCGAGGCGGGGACG
GCCAAGGCGGCGGATACGGGCGACAAGGAGCGGCGAGACGAGGGGACGAAGCGGACGAGCTCGCGGATCCGAGAC
AAGACGCCGGAGACGGCGCGGTACCGATGCCTGCGATGGGAGAACACGATGGCTCTCGAGACACTGGGTCACCTG
CACGCGGAGCAGCCGCCGCCACCGCGACCGAAGAAGCAGTCGAGGAAGAGGGAGGCGGCTGGCGAGGCGGCGGGA
CGAGGGCCGGCCAAGACGAGGCGGCGATAG
Transcript >Ophun1|6561
ATGGTAATCGCCGCTGTTTTTTCCCGTCCAACCCGGACCGCGCTCACTCTTGCTTCTCTGCCTATCCAGGTTCTC
TTCAAGCGGAAACCCGTCAAGTTTCTGTCGCCTCCGGATATTGACGATGACGCTGCAGAGGTCTGGCACATCGCC
CAGACCGGCGAGGTTTTCATCACCTACGAAGACTATCTGAGTCGCATGGAGTTTTACAAACAGCGCCGCTTCAAC
GACCAGATCACCGGTCACTCGGGCCTTACCTTTTTCGAGGCCTTTACCAGCGAGCTCGCCGGAGGCCGCGAGGTT
GACCTCAGCTTCCCAGAGGCTCTCAAAGGGCCCATCCTGCGCAAGGTTCAGTTCCAGACCATCTCCCGCCTCGAC
AACCTCGTCGACATGATATACGACGAGTTCAAGCACGACTTCTACCCCGGCGAGGAGGTCACCGTCACCGTCGAC
GGCGGCGATCGAGTCCACGGCCTGGTCCGCGACAAGACTTCGTTTGGGCCCCGCATCCTACCCGACGGCTCCCAC
GCACAGCCCATGACCCGCTACCTCGTCAACATCAAGGACACCGAGGAGGAGACCATGGTCACCGACGAGCACATC
TGCCGCGACCGTGGCACCTTCACAAAGTCGATGCTGAGGTCCTTTATTAAGAAGACGGTCATCCGGGAGGCCTGG
ACCGGCGCCCCGTGGCTCGTCAAACACGACTACGCCGCCCAGCACCACATCGACACCCGAGTGCCCCCCCAGCTC
CGCTACGATACAAAGGTCCAGGAGCGCCGACAGCTCCAGGCCCAGAAACGCGCCACCCCCCACGACGCCAACGCA
AACGGCGCCACCACCGCTGCCGCCACCATGAATCAGGGCCCCGTACGCCTGCCCGAGCTCAAGCCCGCGCCAAAG
AGCCACAAGGGCAAGCAGGGCTCCCAGGGCGCAAAGGGCCTCAAGTGGCCCCCTACCATGTCGCTCAACGGCGCC
AACGGCTACGGCCACCATCATCATCACCACTCCGCCGCCGACAGCCACCGCGCAGCCGGCCTGCGAGATCCGCCC
TCGCCGCCGTCGCCGCCGCCGCCGCCGCCGCCAAAGTATCCGATCGACGACCTCCTGCTCGAGCCTAAGCAAGGC
AGCACGCGGCCCCGAATCAGCTTCATGTGCAGGGACCCCCCCGTCGACGTCGGGGGCCGCGGGACCATGCACAAT
CGCATCGACATGGCATCCGTCGGCGCCCTCCTCGAGACGTGGGATACACTCAACGTCTACTGCGAAATCTTTCGT
CTCGACTCGTTCACCTTTGACGACTTTGTCGAGGCCATGTCGGTGGCCTCGGACCGCGTCCACGTGCAGCTGTTT
GAGGAGATACACTGCGCCGTCCTCAAGATCCTCGTCGAGTCCGAGTCCGACGGCGGCAGGGTCTGCATCGCCCTC
CCCGACTTGGGCGACGACGCCGCCGACGGAGACGCCGCCGTCGGGCTACAGAGCCCCGATCCCACGCCCGAGCCG
GAGCCGAAGCCGACGGGGCGCGCCACCCGCAGCAGCCTCGCCAAGCTCGAGGCCGAGCGGCTGGCGGCCGAGGCG
GCAGCGGCCGAAGAGGAGAGCCTCCGGGCTGAGCTCGCGTCCAAGCACCGGGCCGAGGAGCTCCTCAAGGAATAC
GACTGGATCGAGCACCTGCGCAAGCGCGACTTTGCCCACGGCGGCTGGCAGAGGATCATCGTCGGTCTGCTGCAC
CAGTTGTCCAAGAAGGAGCGCCGGGAGAAGGCGTGCGAGGAGCTGCTGCTGCAGCTGGTGCCGCCCAATACGAAC
CCGACGCAAGAGGCGGTGCGGCAGACGTACGCCAGGCTCGACATCAACTACCGCGTCCGGGCGCTGCAGATCCTC
TGCATGCTGACCATGGAGACCAAGGCAGTCAGGGCTTACATGGAGGACTGCAGCGAGGCCATGACCAAGTATCGC
AAGGACAGGATCGAGTGGCAGAGGCAGCGGAAGCAGGCGATGGAGGATCTTAGGCAGCTCAACGAGGAGCGAAAG
GCCTTGATGCCCGACGTGACGCCCCCCGAATATCATCCCATCAAGGAAGAAGACGTCAAGATGGCAGACGACTCT
CTCTTGGATAAGGACGAGGACGGAGAAGGTGACGCGGGCAAGTCGCACAAAAAGCGCCGAAGCCGTGGTCCGACG
GAGAAGCAGCGCAAGCGCGAAGAGGAGAGGGAACGAAAGATGCGAGACAAGGAAAAGGGGCGGGACGGCGTCAAG
GGTGCCAAGGGGACGACGAAGCTGCCGCCTCAGCAGCAGAAGCAGTACAACAAGCTGCTCAAGGAGATACAGAAG
CGCGAGGACACGATCAAGGAATGCGAGACGGAAATCGGCGTCATCGAAAACGATTTGCGCGAGGCCGACTGCGCC
AGGACGCGGGTCCTGGGCAAGGATCGCTTCTGGAACCGTTACTACTGGTTCGAACGCAACGGCATGCCCTACGGC
GGACTCCCCAACAGCTCGACGGCCTCTGCCGAGTACGCCAACGGCTGCATCTGGGTGCAGGGCCCGGACGAGCTG
GAGCGGACGGGCTACATCGACGTGCCGGCCGACGTGGAAAACGAGTACCGGGCGCGGTTCGACATGACGATAGCC
GAGCGCAAGGAGCGTGAGGAGGACGGGACGAGCGTCTTCAACGCGACGCAATGGGGCTTCATCTGCGAGCCCGAC
GACGTGGACCGACTGATCCGCTGGCTGGACCCGCGCGGCCTCAACGAGCTGAAGCTGCGCAAGGAGCTCCTCAAC
TACCGCGACAAGATGGCGACGCACATGGAGAGGCGCAAGAAGTACCTGTCGGAGGCCGAGGCCGAGGCGGGGACG
GCCAAGGCGGCGGATACGGGCGACAAGGAGCGGCGAGACGAGGGGACGAAGCGGACGAGCTCGCGGATCCGAGAC
AAGACGCCGGAGACGGCGCGGTACCGATGCCTGCGATGGGAGAACACGATGGCTCTCGAGACACTGGGTCACCTG
CACGCGGAGCAGCCGCCGCCACCGCGACCGAAGAAGCAGTCGAGGAAGAGGGAGGCGGCTGGCGAGGCGGCGGGA
CGAGGGCCGGCCAAGACGAGGCGGCGATAG
Gene >Ophun1|6561
ATGGTAATCGCCGCTGTTTTTTCCCGTCCAACCCGGACCGCGCTCACTCTTGCTTCTCTGCCTATCCAGGTTCTC
TTCAAGCGGAAACCCGTCAAGTTTCTGTCGCCTCCGGATATTGACGATGACGCTGCAGAGGTGACGTATCCCCTA
TTAAACAAGCGACGCGTCTTCTCACTCTTCCCCTACAGGTCTGGCACATCGCCCAGACCGGCGAGGTTTTCATCA
CCTACGAAGACTATCTGAGTCGGTTAGTCTTCCTGTTTTCCCTCTGACCCGACGCCCCCGAAGCTGACGTCTCTG
TCCAGCATGGAGTTTTACAAACAGGTAGCCCGTTTTTCCCGACGCCTTCCGGCCCGTGACGCGACTTCTCTGACC
CTCTTCCCCTCTCGAGCAGCGCCGCTTCAACGACCAGATCACCGGTCACTCGGGCCTTACCTTTTTCGAGGCCTT
TACCAGCGAGGTGGGTTCCCTGCCCCCTGGATTCGTACACCGACCATCCTGTGCGACGCCGTGACGAGCCAGCTG
CTCACAAACATTTTTGACGTCTAGCTCGCCGGAGGCCGCGAGGTTGACCTCAGCTTCCCAGAGGCTCTCAAAGGG
CCCATCCTGCGCAAGGTTCAGTTCCAGACCATCTCCCGCCTCGACAACCTCGTCGACATGATATACGACGAGTTC
AAGCACGACTTCTACCCCGGCGAGGAGGTCACCGTCACCGTCGACGGCGGCGATCGAGTCCACGGCCTGGTCCGC
GACAAGACTTCGTTTGGGCCCCGCATCCTACCCGACGGCTCCCACGCACAGCCCATGACCCGCTACCTCGTCAAC
ATCAAGGACACCGAGGAGGAGACCATGGTCACCGACGAGCACATCTGCCGCGACCGTGGCACCTTCACAAAGTCG
ATGCTGAGGTCCTTTATTAAGAAGACGGTCATCCGGGAGGCCTGGACCGGCGCCCCGTGGCTCGTCAAACACGAC
TACGCCGCCCAGCACCACATCGACACCCGAGTGCCCCCCCAGCTCCGCTACGATACAAAGGTCCAGGAGCGCCGA
CAGCTCCAGGCCCAGAAACGCGCCACCCCCCACGACGCCAACGCAAACGGCGCCACCACCGCTGCCGCCACCATG
AATCAGGGCCCCGTACGCCTGCCCGAGCTCAAGCCCGCGCCAAAGAGCCACAAGGGCAAGCAGGGCTCCCAGGGC
GCAAAGGGCCTCAAGTGGCCCCCTACCATGTCGCTCAACGGCGCCAACGGCTACGGCCACCATCATCATCACCAC
TCCGCCGCCGACAGCCACCGCGCAGCCGGCCTGCGAGATCCGCCCTCGCCGCCGTCGCCGCCGCCGCCGCCGCCG
CCAAAGTATCCGATCGACGACCTCCTGCTCGAGCCTAAGCAAGGCAGCACGCGGCCCCGAATCAGCTTCATGTGC
AGGGACCCCCCCGTCGACGTCGGGGGCCGCGGGACCATGCACAATCGCATCGACATGGCATCCGTCGGCGCCCTC
CTCGAGACGTGGGATACACTCAACGTCTACTGCGAAATCTTTCGTCTCGACTCGTTCACCTTTGACGACTTTGTC
GAGGCCATGTCGGTGGCCTCGGACCGCGTCCACGTGCAGCTGTTTGAGGAGATACACTGCGCCGTCCTCAAGATC
CTCGTCGAGTCCGAGTCCGACGGCGGCAGGGTCTGCATCGCCCTCCCCGACTTGGGCGACGACGCCGCCGACGGA
GACGCCGCCGTCGGGCTACAGAGCCCCGATCCCACGCCCGAGCCGGAGCCGAAGCCGACGGGGCGCGCCACCCGC
AGCAGCCTCGCCAAGCTCGAGGCCGAGCGGCTGGCGGCCGAGGCGGCAGCGGCCGAAGAGGAGAGCCTCCGGGCT
GAGCTCGCGTCCAAGCACCGGGCCGAGGAGCTCCTCAAGGAATACGACTGGATCGAGCACCTGCGCAAGCGCGAC
TTTGCCCACGGCGGCTGGCAGAGGATCATCGTCGGTCTGCTGCACCAGTTGTCCAAGAAGGAGCGCCGGGAGAAG
GCGTGCGAGGAGCTGCTGCTGCAGCTGGTGCCGCCCAATACGAACCCGACGCAAGAGGCGGTGCGGCAGACGTAC
GCCAGGCTCGACATCAACTACCGCGTCCGGGCGCTGCAGATCCTCTGCATGCTGACCATGGAGACCAAGGCAGTC
AGGGCTTACATGGAGGACTGCAGCGAGGCCATGACCAAGTATCGCAAGGACAGGATCGAGTGGCAGAGGCAGCGG
AAGCAGGCGTGAGTACTCGAGCGACCCCATCTTTCCTCCCACCTCCCCCGGATGCTGACGCTTCTCAGGATGGAG
GATCTTAGGCAGCTCAACGAGGAGCGAAAGGCCTTGATGCCCGACGTGACGCCCCCCGAATATCATCCCATCAAG
GAAGAAGACGTCAAGATGGCAGACGACTCTCTCTTGGATAAGGACGAGGACGGAGAAGGTGACGCGGGCAAGTCG
CACAAAAAGCGCCGAAGCCGTGGTCCGACGGAGAAGCAGCGCAAGCGCGAAGAGGAGAGGGAACGAAAGATGCGA
GACAAGGAAAAGGGGCGGGACGGCGTCAAGGGTGCCAAGGGGACGACGAAGCTGCCGCCTCAGCAGCAGAAGCAG
TACAACAAGCTGCTCAAGGAGATACAGAAGCGCGAGGACACGATCAAGGAATGCGAGACGGAAATCGGCGTCATC
GAAAACGATTTGCGCGAGGCCGACTGCGCCAGGACGCGGGTCCTGGGCAAGGATCGCTTCTGGAACCGTTACTAC
TGGTTCGAACGCAACGGCATGCCCTACGGCGGACTCCCCAACAGCTCGACGGCCTCTGCCGAGTACGCCAACGGC
TGCATCTGGGTGCAGGGCCCGGACGAGCTGGAGCGGACGGGCTACATCGACGTGCCGGCCGACGTGGAAAACGAG
TACCGGGCGCGGTTCGACATGACGATAGCCGAGCGCAAGGAGCGTGAGGAGGACGGGACGAGCGTCTTCAACGCG
ACGCAATGGGGCTTCATCTGCGAGCCCGACGACGTGGACCGACTGATCCGCTGGCTGGACCCGCGCGGCCTCAAC
GAGCTGAAGCTGCGCAAGGAGCTCCTCAACTACCGCGACAAGATGGCGACGCACATGGAGAGGCGCAAGAAGTAC
CTGTCGGAGGCCGAGGCCGAGGCGGGGACGGCCAAGGCGGCGGATACGGGCGACAAGGAGCGGCGAGACGAGGGG
ACGAAGCGGACGAGCTCGCGGATCCGAGACAAGACGCCGGAGACGGCGCGGTACCGATGCCTGCGATGGGAGAAC
ACGATGGCTCTCGAGACACTGGGTCACCTGCACGCGGAGCAGCCGCCGCCACCGCGACCGAAGAAGCAGTCGAGG
AAGAGGGAGGCGGCTGGCGAGGCGGCGGGACGAGGGCCGGCCAAGACGAGGCGGCGATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail