Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6557
Gene name
LocationContig_724:76..2229
Strand-
Gene length (bp)2153
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07576 BRAP2 BRCA1-associated protein 2 1.0E-26 207 298
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 7.6E-18 407 465
PF13639 zf-RING_2 Ring finger domain 9.2E-09 335 375
PF17123 zf-RING_11 RING-like zinc finger 5.0E-07 336 363
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.5E-06 336 374

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 152 591 2.0E-92
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 181 620 8.0E-76
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 104 599 2.0E-64
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 179 612 2.0E-64
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 179 599 1.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 152 591 2.0E-92
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 181 620 8.0E-76
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 104 599 2.0E-64
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 179 612 2.0E-64
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 179 599 1.0E-59
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 407 492 2.0E-07
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 407 464 2.0E-07
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 407 464 3.0E-07
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 407 464 3.0E-07
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 407 476 3.0E-07
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 407 464 5.0E-07
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 407 479 2.0E-06
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 407 502 2.0E-06
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 407 466 2.0E-06
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens GN=USP49 PE=1 SV=1 407 491 2.0E-06
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 394 441 5.0E-06
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 394 441 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup4971
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4934
Ophiocordyceps australis map64 (Brazil) OphauB2|949
Ophiocordyceps camponoti-floridani Ophcf2|01543
Ophiocordyceps camponoti-rufipedis Ophun1|6557 (this protein)
Ophiocordyceps kimflemingae Ophio5|4878
Ophiocordyceps subramaniannii Hirsu2|2106

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6557
MVTPRYYYHLQFDLYPTPNPESEGPSKERAGGIWLPPPGASAFDRLPSHPTRERAIRDDRRERGGEAREERGLGR
ERELQSESRSVDESRILQPSVIDCGSRRSDEEPRRRRRTLSSPTAATQTATIRDWRFGRVSIDTADPITMSPTET
GKAAPPLGPSFGGASATKAEWLPLDTKHTELGWGVVRFYRDGDEVPTSADDDDESGDGDCCVLCIPAVPAYMSPG
DFMGFVGDRWMGDISHCRMVMTSSMNRYLVLLRFREGERARLWKREFDGKVFNSIESRVCHVVMVKSITFSRNHH
PVATAPSSSSSSAAVVSSSLKPFPPPTPNLIELPTCPVCLERMDETNGLMTIPCSHVFHCNCLQNWRGAGCPVCR
FTNASSQAGAGVGDDGDDPNSRSFGAPVSNLCSVCDCADDLWICLICGHVGCGRYKGGHAKDHWKDTAHCFALEL
ETQHVWDYAGDVWVHRLIRDKGDGKVVELPGRGSPHDGQQQQQQHEDQDVVPRAKLENIGLEYTHLITSQLESQR
AYYEDMISKAADKAAASAASAEASAAQTVHLTARLSLLEERHEALQTTTLPQLERDVERQRSKAERAEKLARDLS
RSLQEEKKKGEEGEEEMREEEIVL*
Coding >Ophun1|6557
ATGGTAACTCCCCGTTACTACTATCACCTCCAGTTCGATCTCTATCCTACACCGAATCCCGAGAGCGAGGGGCCG
TCGAAAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCGCGAGCGGGCGATCCGCGACGATAGGAGAGAGAGGGGAGGAGAGGCCCGGGAGGAGAGGGGACTCGGGAGA
GAGAGAGAGTTACAGAGCGAGAGCAGATCGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGA
AGCAGACGCAGCGACGAGGAACCACGCAGACGGCGCAGGACGCTATCGAGCCCAACAGCTGCGACACAGACGGCT
ACGATTCGAGACTGGCGCTTCGGAAGAGTGAGCATCGACACAGCCGATCCCATCACCATGTCCCCTACCGAGACG
GGCAAGGCAGCGCCTCCGCTGGGCCCATCCTTTGGCGGCGCCTCTGCCACTAAGGCTGAGTGGCTACCGCTGGAC
ACGAAACATACAGAGCTGGGATGGGGCGTCGTCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGAC
GACGACGACGAGTCGGGCGATGGGGACTGCTGTGTGCTCTGCATTCCCGCTGTGCCGGCGTACATGTCGCCGGGG
GACTTTATGGGCTTCGTTGGGGATCGGTGGATGGGCGATATTAGCCACTGTCGGATGGTTATGACGTCGAGCATG
AATCGGTATTTGGTCTTGTTGAGGTTTCGGGAGGGTGAGAGGGCGAGGCTTTGGAAGCGGGAGTTTGATGGCAAG
GTGTTTAACTCGATCGAGTCTCGAGTCTGTCACGTTGTTATGGTCAAGTCGATTACCTTTTCACGCAACCATCAT
CCCGTGGCGACGGCACCATCATCGTCGTCTTCGTCAGCCGCCGTCGTCTCCAGCAGCCTCAAGCCCTTCCCACCA
CCGACGCCCAACCTCATCGAGCTGCCTACCTGCCCCGTCTGCCTGGAGAGAATGGACGAAACCAACGGGCTGATG
ACGATACCGTGCTCGCACGTCTTTCACTGCAACTGTCTTCAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGC
TTTACAAACGCCTCGTCCCAGGCGGGCGCTGGCGTTGGCGATGACGGCGATGATCCTAACTCGCGGTCGTTTGGG
GCTCCCGTTTCGAATCTCTGCAGTGTTTGCGACTGTGCCGACGATCTTTGGATCTGTCTTATTTGCGGGCACGTT
GGTTGTGGGCGGTATAAGGGTGGGCATGCGAAGGATCATTGGAAGGATACGGCTCATTGCTTTGCGCTGGAGCTT
GAGACGCAGCATGTCTGGGATTATGCTGGTGATGTCTGGGTGCATCGGTTGATCCGTGACAAGGGGGATGGCAAG
GTGGTTGAGCTGCCGGGGAGAGGGAGTCCCCATGACGGACAGCAACAACAGCAGCAACACGAAGACCAAGACGTC
GTGCCGCGGGCCAAGCTGGAGAACATTGGGCTCGAGTACACGCATCTGATTACCAGTCAGCTGGAGTCACAGCGA
GCCTACTACGAAGACATGATCAGCAAGGCAGCCGACAAGGCCGCCGCCTCAGCAGCCTCCGCCGAAGCCAGCGCA
GCGCAAACAGTCCATCTAACCGCCCGCCTCTCCCTCCTAGAAGAGCGCCACGAAGCCCTCCAGACCACAACGCTC
CCCCAACTGGAGCGCGACGTGGAGAGACAGCGCAGCAAAGCAGAGCGGGCGGAGAAGCTGGCGCGCGATCTGAGC
CGTTCGCTGCAGGAGGAGAAGAAGAAGGGGGAGGAGGGGGAGGAGGAGATGAGGGAGGAGGAGATTGTTCTCTGA
Transcript >Ophun1|6557
ATGGTAACTCCCCGTTACTACTATCACCTCCAGTTCGATCTCTATCCTACACCGAATCCCGAGAGCGAGGGGCCG
TCGAAAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCGCGAGCGGGCGATCCGCGACGATAGGAGAGAGAGGGGAGGAGAGGCCCGGGAGGAGAGGGGACTCGGGAGA
GAGAGAGAGTTACAGAGCGAGAGCAGATCGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGA
AGCAGACGCAGCGACGAGGAACCACGCAGACGGCGCAGGACGCTATCGAGCCCAACAGCTGCGACACAGACGGCT
ACGATTCGAGACTGGCGCTTCGGAAGAGTGAGCATCGACACAGCCGATCCCATCACCATGTCCCCTACCGAGACG
GGCAAGGCAGCGCCTCCGCTGGGCCCATCCTTTGGCGGCGCCTCTGCCACTAAGGCTGAGTGGCTACCGCTGGAC
ACGAAACATACAGAGCTGGGATGGGGCGTCGTCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGAC
GACGACGACGAGTCGGGCGATGGGGACTGCTGTGTGCTCTGCATTCCCGCTGTGCCGGCGTACATGTCGCCGGGG
GACTTTATGGGCTTCGTTGGGGATCGGTGGATGGGCGATATTAGCCACTGTCGGATGGTTATGACGTCGAGCATG
AATCGGTATTTGGTCTTGTTGAGGTTTCGGGAGGGTGAGAGGGCGAGGCTTTGGAAGCGGGAGTTTGATGGCAAG
GTGTTTAACTCGATCGAGTCTCGAGTCTGTCACGTTGTTATGGTCAAGTCGATTACCTTTTCACGCAACCATCAT
CCCGTGGCGACGGCACCATCATCGTCGTCTTCGTCAGCCGCCGTCGTCTCCAGCAGCCTCAAGCCCTTCCCACCA
CCGACGCCCAACCTCATCGAGCTGCCTACCTGCCCCGTCTGCCTGGAGAGAATGGACGAAACCAACGGGCTGATG
ACGATACCGTGCTCGCACGTCTTTCACTGCAACTGTCTTCAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGC
TTTACAAACGCCTCGTCCCAGGCGGGCGCTGGCGTTGGCGATGACGGCGATGATCCTAACTCGCGGTCGTTTGGG
GCTCCCGTTTCGAATCTCTGCAGTGTTTGCGACTGTGCCGACGATCTTTGGATCTGTCTTATTTGCGGGCACGTT
GGTTGTGGGCGGTATAAGGGTGGGCATGCGAAGGATCATTGGAAGGATACGGCTCATTGCTTTGCGCTGGAGCTT
GAGACGCAGCATGTCTGGGATTATGCTGGTGATGTCTGGGTGCATCGGTTGATCCGTGACAAGGGGGATGGCAAG
GTGGTTGAGCTGCCGGGGAGAGGGAGTCCCCATGACGGACAGCAACAACAGCAGCAACACGAAGACCAAGACGTC
GTGCCGCGGGCCAAGCTGGAGAACATTGGGCTCGAGTACACGCATCTGATTACCAGTCAGCTGGAGTCACAGCGA
GCCTACTACGAAGACATGATCAGCAAGGCAGCCGACAAGGCCGCCGCCTCAGCAGCCTCCGCCGAAGCCAGCGCA
GCGCAAACAGTCCATCTAACCGCCCGCCTCTCCCTCCTAGAAGAGCGCCACGAAGCCCTCCAGACCACAACGCTC
CCCCAACTGGAGCGCGACGTGGAGAGACAGCGCAGCAAAGCAGAGCGGGCGGAGAAGCTGGCGCGCGATCTGAGC
CGTTCGCTGCAGGAGGAGAAGAAGAAGGGGGAGGAGGGGGAGGAGGAGATGAGGGAGGAGGAGATTGTTCTCTGA
Gene >Ophun1|6557
ATGGTAACTCCCCGTTACTACTATCACCTCCAGTTCGATCTCTATCCTACACCGAATCCCGAGAGCGAGGGGCCG
TCGAAAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCGCGAGCGGGCGATCCGCGACGATAGGAGAGAGAGGGGAGGAGAGGCCCGGGAGGAGAGGGGACTCGGGAGA
GAGAGAGAGTTACAGAGCGAGAGCAGATCGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGA
AGCAGACGCAGCGACGAGGAACCACGCAGACGGCGCAGGACGCTATCGAGCCCAACAGCTGCGACACAGACGGCT
ACGATTCGAGACTGGCGCTTCGGAAGAGTGAGCATCGACACAGCCGATCCCATCACCATGTCCCCTACCGAGACG
GGCAAGGCAGCGCCTCCGCTGGGCCCATCCTTTGGCGGCGCCTCTGCCACTAAGGCTGAGTGGCTACCGCTGGAC
ACGAAACATACAGAGCTGGGATGGGGCGTCGTCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGAC
GACGACGACGAGTCGGGCGATGGGGACTGCTGTGTGCTCTGCATTCCCGCTGTGCCGGCGTACATGTCGCCGGGG
GACTTTATGGGCTTCGTTGGGGATCGGTGGATGGGCGATATTAGCCACTGTCGGATGGTTATGACGTCGAGCATG
AATCGGTATTTGGTCTTGTTGAGGTTTCGGGAGGGTGAGAGGGCGAGGCTTTGGAAGCGGGAGTTTGATGGCAAG
GTGTTTAACTCGATCGAGGTGAGTTGCCACTTGATCCCATCACCGTCGCTTGGTTACCTATGCTGACGGGCAAAG
TCTCGAGTCTGTCACGTTGTTATGGTCAAGTCGATTACCTTTTCACGCAACCATCATCCCGTGGCGACGGCACCA
TCATCGTCGTCTTCGTCAGCCGCCGTCGTCTCCAGCAGCCTCAAGCCCTTCCCACCACCGACGCCCAACCTCATC
GAGCTGCCTACCTGCCCCGTCTGCCTGGAGAGAATGGACGAAACCAACGGGCTGATGACGATACCGTGCTCGCAC
GTCTTTCACTGCAACTGTCTTCAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGCTTTACAAACGCCTCGTCC
CAGGCGGGCGCTGGCGTTGGCGATGACGGCGATGATCCTAACTCGCGGTCGTTTGGGGCTCCCGTTTCGAATCTC
TGCAGTGTTTGCGACTGTGCCGACGATCTTTGGATCTGTCTTATTTGCGGGCACGTTGGTTGTGGGCGGTATAAG
GGTGGGCATGCGAAGGATCATTGGAAGGATACGGCTCATTGCTTTGCGCTGGAGCTTGAGACGCAGCATGTCTGG
GATTATGCTGGTGATGTCTGGGTGCATCGGTTGATCCGTGACAAGGGGGATGGCAAGGTGGTTGAGCTGCCGGGG
AGAGGGAGTCCCCATGACGGACAGCAACAACAGCAGCAACACGAAGACCAAGACGTCGTGCCGCGGGCCAAGCTG
GAGAACATTGGGCTCGAGTACACGCATCTGATTACCAGTCAGCTGGAGTCACAGCGAGCCTACTACGAAGACATG
ATCAGCAAGGCAGCCGACAAGGCCGCCGCCTCAGCAGCCTCCGCCGAAGCCAGCGCAGCGCAAACAGTCCATCTA
ACCGCCCGCCTCTCCCTCCTAGAAGAGCGCCACGAAGCCCTCCAGACCACAACGCTCCCCCAACTGGAGCGCGAC
GTGGAGAGACAGCGCAGCAAAGCAGAGCGGGCGGAGAAGCTGGCGCGCGATCTGAGCCGTTCGCTGCAGGAGGAG
AAGAAGGTGAATGAGGGGCTGATGCAGCGGATTGCGCATCTCGAGGGAGGGCTTGCGGCTGCCAAGGCTGAGGTT
GAGAAGCTGGGGGGGGAGAAGGGGGAGTTGGAGGAGTTGAATCGCGATTTGTCGGCTTTTATTTCGGGGGCGGAG
AGGTTGAGGGAGTTGGAGAGGGAGGGGGTGGTTGGGGAGGGGGAGGTTGTTGAGGGGACGGTTGGGGTTGGGGGC
AGAAGGGGGAGGAGGGGGAGGAGGAGATGAGGGAGGAGGAGATTGTTCTCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail