Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6557
Gene name
LocationContig_724:76..2229
Strand-
Gene length (bp)2153
Transcript length (bp)1875
Coding sequence length (bp)1875
Protein length (aa) 625

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07576 BRAP2 BRCA1-associated protein 2 1.0E-26 207 298
PF02148 zf-UBP Zn-finger in ubiquitin-hydrolases and other protein 7.6E-18 407 465
PF13639 zf-RING_2 Ring finger domain 9.2E-09 335 375
PF17123 zf-RING_11 RING-like zinc finger 5.0E-07 336 363
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 4.5E-06 336 374

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 152 591 2.0E-92
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 181 620 8.0E-76
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 104 599 2.0E-64
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 179 612 2.0E-64
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 179 599 1.0E-59
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13747|EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC16E8.13 PE=3 SV=1 152 591 2.0E-92
sp|P38748|ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ETP1 PE=1 SV=1 181 620 8.0E-76
sp|Q99MP8|BRAP_MOUSE BRCA1-associated protein OS=Mus musculus GN=Brap PE=1 SV=1 104 599 2.0E-64
sp|Q7Z569|BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens GN=BRAP PE=1 SV=2 179 612 2.0E-64
sp|Q95QN6|BRAP2_CAEEL BRCA1-associated protein homolog 2 OS=Caenorhabditis elegans GN=brap-2 PE=3 SV=1 179 599 1.0E-59
sp|D2HBJ8|UBP44_AILME Ubiquitin carboxyl-terminal hydrolase 44 OS=Ailuropoda melanoleuca GN=USP44 PE=3 SV=1 407 492 2.0E-07
sp|Q0V9G5|UBP44_XENTR Ubiquitin carboxyl-terminal hydrolase 44 OS=Xenopus tropicalis GN=usp44 PE=2 SV=1 407 464 2.0E-07
sp|Q5XGZ2|UP44B_XENLA Ubiquitin carboxyl-terminal hydrolase 44-B OS=Xenopus laevis GN=usp44-b PE=2 SV=1 407 464 3.0E-07
sp|Q6NTR6|UP44A_XENLA Ubiquitin carboxyl-terminal hydrolase 44-A OS=Xenopus laevis GN=usp44-a PE=2 SV=1 407 464 3.0E-07
sp|Q7ZUM8|UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio GN=usp44 PE=2 SV=1 407 476 3.0E-07
sp|Q9H0E7|UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens GN=USP44 PE=1 SV=2 407 464 5.0E-07
sp|Q8C2S0|UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus GN=Usp44 PE=2 SV=3 407 479 2.0E-06
sp|Q6P9L4|UBP49_MOUSE Ubiquitin carboxyl-terminal hydrolase 49 OS=Mus musculus GN=Usp49 PE=2 SV=1 407 502 2.0E-06
sp|Q54QE6|SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum GN=sir2A PE=2 SV=1 407 466 2.0E-06
sp|Q70CQ1|UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens GN=USP49 PE=1 SV=1 407 491 2.0E-06
sp|Q91W36|UBP3_MOUSE Ubiquitin carboxyl-terminal hydrolase 3 OS=Mus musculus GN=Usp3 PE=2 SV=1 394 441 5.0E-06
sp|Q9Y6I4|UBP3_HUMAN Ubiquitin carboxyl-terminal hydrolase 3 OS=Homo sapiens GN=USP3 PE=1 SV=2 394 441 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0008270 zinc ion binding Yes
GO:0003674 molecular_function No
GO:0043169 cation binding No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 43 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6557
MVTPRYYYHLQFDLYPTPNPESEGPSKERAGGIWLPPPGASAFDRLPSHPTRERAIRDDRRERGGEAREERGLGR
ERELQSESRSVDESRILQPSVIDCGSRRSDEEPRRRRRTLSSPTAATQTATIRDWRFGRVSIDTADPITMSPTET
GKAAPPLGPSFGGASATKAEWLPLDTKHTELGWGVVRFYRDGDEVPTSADDDDESGDGDCCVLCIPAVPAYMSPG
DFMGFVGDRWMGDISHCRMVMTSSMNRYLVLLRFREGERARLWKREFDGKVFNSIESRVCHVVMVKSITFSRNHH
PVATAPSSSSSSAAVVSSSLKPFPPPTPNLIELPTCPVCLERMDETNGLMTIPCSHVFHCNCLQNWRGAGCPVCR
FTNASSQAGAGVGDDGDDPNSRSFGAPVSNLCSVCDCADDLWICLICGHVGCGRYKGGHAKDHWKDTAHCFALEL
ETQHVWDYAGDVWVHRLIRDKGDGKVVELPGRGSPHDGQQQQQQHEDQDVVPRAKLENIGLEYTHLITSQLESQR
AYYEDMISKAADKAAASAASAEASAAQTVHLTARLSLLEERHEALQTTTLPQLERDVERQRSKAERAEKLARDLS
RSLQEEKKKGEEGEEEMREEEIVL*
Coding >Ophun1|6557
ATGGTAACTCCCCGTTACTACTATCACCTCCAGTTCGATCTCTATCCTACACCGAATCCCGAGAGCGAGGGGCCG
TCGAAAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCGCGAGCGGGCGATCCGCGACGATAGGAGAGAGAGGGGAGGAGAGGCCCGGGAGGAGAGGGGACTCGGGAGA
GAGAGAGAGTTACAGAGCGAGAGCAGATCGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGA
AGCAGACGCAGCGACGAGGAACCACGCAGACGGCGCAGGACGCTATCGAGCCCAACAGCTGCGACACAGACGGCT
ACGATTCGAGACTGGCGCTTCGGAAGAGTGAGCATCGACACAGCCGATCCCATCACCATGTCCCCTACCGAGACG
GGCAAGGCAGCGCCTCCGCTGGGCCCATCCTTTGGCGGCGCCTCTGCCACTAAGGCTGAGTGGCTACCGCTGGAC
ACGAAACATACAGAGCTGGGATGGGGCGTCGTCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGAC
GACGACGACGAGTCGGGCGATGGGGACTGCTGTGTGCTCTGCATTCCCGCTGTGCCGGCGTACATGTCGCCGGGG
GACTTTATGGGCTTCGTTGGGGATCGGTGGATGGGCGATATTAGCCACTGTCGGATGGTTATGACGTCGAGCATG
AATCGGTATTTGGTCTTGTTGAGGTTTCGGGAGGGTGAGAGGGCGAGGCTTTGGAAGCGGGAGTTTGATGGCAAG
GTGTTTAACTCGATCGAGTCTCGAGTCTGTCACGTTGTTATGGTCAAGTCGATTACCTTTTCACGCAACCATCAT
CCCGTGGCGACGGCACCATCATCGTCGTCTTCGTCAGCCGCCGTCGTCTCCAGCAGCCTCAAGCCCTTCCCACCA
CCGACGCCCAACCTCATCGAGCTGCCTACCTGCCCCGTCTGCCTGGAGAGAATGGACGAAACCAACGGGCTGATG
ACGATACCGTGCTCGCACGTCTTTCACTGCAACTGTCTTCAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGC
TTTACAAACGCCTCGTCCCAGGCGGGCGCTGGCGTTGGCGATGACGGCGATGATCCTAACTCGCGGTCGTTTGGG
GCTCCCGTTTCGAATCTCTGCAGTGTTTGCGACTGTGCCGACGATCTTTGGATCTGTCTTATTTGCGGGCACGTT
GGTTGTGGGCGGTATAAGGGTGGGCATGCGAAGGATCATTGGAAGGATACGGCTCATTGCTTTGCGCTGGAGCTT
GAGACGCAGCATGTCTGGGATTATGCTGGTGATGTCTGGGTGCATCGGTTGATCCGTGACAAGGGGGATGGCAAG
GTGGTTGAGCTGCCGGGGAGAGGGAGTCCCCATGACGGACAGCAACAACAGCAGCAACACGAAGACCAAGACGTC
GTGCCGCGGGCCAAGCTGGAGAACATTGGGCTCGAGTACACGCATCTGATTACCAGTCAGCTGGAGTCACAGCGA
GCCTACTACGAAGACATGATCAGCAAGGCAGCCGACAAGGCCGCCGCCTCAGCAGCCTCCGCCGAAGCCAGCGCA
GCGCAAACAGTCCATCTAACCGCCCGCCTCTCCCTCCTAGAAGAGCGCCACGAAGCCCTCCAGACCACAACGCTC
CCCCAACTGGAGCGCGACGTGGAGAGACAGCGCAGCAAAGCAGAGCGGGCGGAGAAGCTGGCGCGCGATCTGAGC
CGTTCGCTGCAGGAGGAGAAGAAGAAGGGGGAGGAGGGGGAGGAGGAGATGAGGGAGGAGGAGATTGTTCTCTGA
Transcript >Ophun1|6557
ATGGTAACTCCCCGTTACTACTATCACCTCCAGTTCGATCTCTATCCTACACCGAATCCCGAGAGCGAGGGGCCG
TCGAAAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCGCGAGCGGGCGATCCGCGACGATAGGAGAGAGAGGGGAGGAGAGGCCCGGGAGGAGAGGGGACTCGGGAGA
GAGAGAGAGTTACAGAGCGAGAGCAGATCGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGA
AGCAGACGCAGCGACGAGGAACCACGCAGACGGCGCAGGACGCTATCGAGCCCAACAGCTGCGACACAGACGGCT
ACGATTCGAGACTGGCGCTTCGGAAGAGTGAGCATCGACACAGCCGATCCCATCACCATGTCCCCTACCGAGACG
GGCAAGGCAGCGCCTCCGCTGGGCCCATCCTTTGGCGGCGCCTCTGCCACTAAGGCTGAGTGGCTACCGCTGGAC
ACGAAACATACAGAGCTGGGATGGGGCGTCGTCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGAC
GACGACGACGAGTCGGGCGATGGGGACTGCTGTGTGCTCTGCATTCCCGCTGTGCCGGCGTACATGTCGCCGGGG
GACTTTATGGGCTTCGTTGGGGATCGGTGGATGGGCGATATTAGCCACTGTCGGATGGTTATGACGTCGAGCATG
AATCGGTATTTGGTCTTGTTGAGGTTTCGGGAGGGTGAGAGGGCGAGGCTTTGGAAGCGGGAGTTTGATGGCAAG
GTGTTTAACTCGATCGAGTCTCGAGTCTGTCACGTTGTTATGGTCAAGTCGATTACCTTTTCACGCAACCATCAT
CCCGTGGCGACGGCACCATCATCGTCGTCTTCGTCAGCCGCCGTCGTCTCCAGCAGCCTCAAGCCCTTCCCACCA
CCGACGCCCAACCTCATCGAGCTGCCTACCTGCCCCGTCTGCCTGGAGAGAATGGACGAAACCAACGGGCTGATG
ACGATACCGTGCTCGCACGTCTTTCACTGCAACTGTCTTCAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGC
TTTACAAACGCCTCGTCCCAGGCGGGCGCTGGCGTTGGCGATGACGGCGATGATCCTAACTCGCGGTCGTTTGGG
GCTCCCGTTTCGAATCTCTGCAGTGTTTGCGACTGTGCCGACGATCTTTGGATCTGTCTTATTTGCGGGCACGTT
GGTTGTGGGCGGTATAAGGGTGGGCATGCGAAGGATCATTGGAAGGATACGGCTCATTGCTTTGCGCTGGAGCTT
GAGACGCAGCATGTCTGGGATTATGCTGGTGATGTCTGGGTGCATCGGTTGATCCGTGACAAGGGGGATGGCAAG
GTGGTTGAGCTGCCGGGGAGAGGGAGTCCCCATGACGGACAGCAACAACAGCAGCAACACGAAGACCAAGACGTC
GTGCCGCGGGCCAAGCTGGAGAACATTGGGCTCGAGTACACGCATCTGATTACCAGTCAGCTGGAGTCACAGCGA
GCCTACTACGAAGACATGATCAGCAAGGCAGCCGACAAGGCCGCCGCCTCAGCAGCCTCCGCCGAAGCCAGCGCA
GCGCAAACAGTCCATCTAACCGCCCGCCTCTCCCTCCTAGAAGAGCGCCACGAAGCCCTCCAGACCACAACGCTC
CCCCAACTGGAGCGCGACGTGGAGAGACAGCGCAGCAAAGCAGAGCGGGCGGAGAAGCTGGCGCGCGATCTGAGC
CGTTCGCTGCAGGAGGAGAAGAAGAAGGGGGAGGAGGGGGAGGAGGAGATGAGGGAGGAGGAGATTGTTCTCTGA
Gene >Ophun1|6557
ATGGTAACTCCCCGTTACTACTATCACCTCCAGTTCGATCTCTATCCTACACCGAATCCCGAGAGCGAGGGGCCG
TCGAAAGAGCGGGCCGGCGGCATCTGGCTGCCGCCGCCGGGAGCCAGCGCCTTTGATCGTCTGCCGTCACATCCG
ACGCGCGAGCGGGCGATCCGCGACGATAGGAGAGAGAGGGGAGGAGAGGCCCGGGAGGAGAGGGGACTCGGGAGA
GAGAGAGAGTTACAGAGCGAGAGCAGATCGGTCGACGAGAGCCGTATCCTACAACCGAGCGTCATCGACTGCGGA
AGCAGACGCAGCGACGAGGAACCACGCAGACGGCGCAGGACGCTATCGAGCCCAACAGCTGCGACACAGACGGCT
ACGATTCGAGACTGGCGCTTCGGAAGAGTGAGCATCGACACAGCCGATCCCATCACCATGTCCCCTACCGAGACG
GGCAAGGCAGCGCCTCCGCTGGGCCCATCCTTTGGCGGCGCCTCTGCCACTAAGGCTGAGTGGCTACCGCTGGAC
ACGAAACATACAGAGCTGGGATGGGGCGTCGTCCGCTTCTACCGCGATGGCGACGAGGTGCCTACTTCGGCTGAC
GACGACGACGAGTCGGGCGATGGGGACTGCTGTGTGCTCTGCATTCCCGCTGTGCCGGCGTACATGTCGCCGGGG
GACTTTATGGGCTTCGTTGGGGATCGGTGGATGGGCGATATTAGCCACTGTCGGATGGTTATGACGTCGAGCATG
AATCGGTATTTGGTCTTGTTGAGGTTTCGGGAGGGTGAGAGGGCGAGGCTTTGGAAGCGGGAGTTTGATGGCAAG
GTGTTTAACTCGATCGAGGTGAGTTGCCACTTGATCCCATCACCGTCGCTTGGTTACCTATGCTGACGGGCAAAG
TCTCGAGTCTGTCACGTTGTTATGGTCAAGTCGATTACCTTTTCACGCAACCATCATCCCGTGGCGACGGCACCA
TCATCGTCGTCTTCGTCAGCCGCCGTCGTCTCCAGCAGCCTCAAGCCCTTCCCACCACCGACGCCCAACCTCATC
GAGCTGCCTACCTGCCCCGTCTGCCTGGAGAGAATGGACGAAACCAACGGGCTGATGACGATACCGTGCTCGCAC
GTCTTTCACTGCAACTGTCTTCAGAACTGGCGCGGAGCCGGCTGTCCCGTCTGCCGCTTTACAAACGCCTCGTCC
CAGGCGGGCGCTGGCGTTGGCGATGACGGCGATGATCCTAACTCGCGGTCGTTTGGGGCTCCCGTTTCGAATCTC
TGCAGTGTTTGCGACTGTGCCGACGATCTTTGGATCTGTCTTATTTGCGGGCACGTTGGTTGTGGGCGGTATAAG
GGTGGGCATGCGAAGGATCATTGGAAGGATACGGCTCATTGCTTTGCGCTGGAGCTTGAGACGCAGCATGTCTGG
GATTATGCTGGTGATGTCTGGGTGCATCGGTTGATCCGTGACAAGGGGGATGGCAAGGTGGTTGAGCTGCCGGGG
AGAGGGAGTCCCCATGACGGACAGCAACAACAGCAGCAACACGAAGACCAAGACGTCGTGCCGCGGGCCAAGCTG
GAGAACATTGGGCTCGAGTACACGCATCTGATTACCAGTCAGCTGGAGTCACAGCGAGCCTACTACGAAGACATG
ATCAGCAAGGCAGCCGACAAGGCCGCCGCCTCAGCAGCCTCCGCCGAAGCCAGCGCAGCGCAAACAGTCCATCTA
ACCGCCCGCCTCTCCCTCCTAGAAGAGCGCCACGAAGCCCTCCAGACCACAACGCTCCCCCAACTGGAGCGCGAC
GTGGAGAGACAGCGCAGCAAAGCAGAGCGGGCGGAGAAGCTGGCGCGCGATCTGAGCCGTTCGCTGCAGGAGGAG
AAGAAGGTGAATGAGGGGCTGATGCAGCGGATTGCGCATCTCGAGGGAGGGCTTGCGGCTGCCAAGGCTGAGGTT
GAGAAGCTGGGGGGGGAGAAGGGGGAGTTGGAGGAGTTGAATCGCGATTTGTCGGCTTTTATTTCGGGGGCGGAG
AGGTTGAGGGAGTTGGAGAGGGAGGGGGTGGTTGGGGAGGGGGAGGTTGTTGAGGGGACGGTTGGGGTTGGGGGC
AGAAGGGGGAGGAGGGGGAGGAGGAGATGAGGGAGGAGGAGATTGTTCTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail