Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6542
Gene name
LocationContig_72:29332..33039
Strand+
Gene length (bp)3707
Transcript length (bp)2682
Coding sequence length (bp)2682
Protein length (aa) 894

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01565 FAD_binding_4 FAD binding domain 7.5E-25 254 388
PF10502 Peptidase_S26 Signal peptidase, peptidase S26 3.3E-06 34 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UST2|IMP2L_SCHPO Mitochondrial inner membrane protease subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC336.13c PE=3 SV=1 27 167 2.0E-27
sp|Q2KI92|IMP2L_BOVIN Mitochondrial inner membrane protease subunit 2 OS=Bos taurus GN=IMMP2L PE=2 SV=1 29 172 5.0E-22
sp|P46972|IMP2_YEAST Mitochondrial inner membrane protease subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP2 PE=1 SV=1 32 166 7.0E-22
sp|Q5PQ63|IMP2L_XENLA Mitochondrial inner membrane protease subunit 2 OS=Xenopus laevis GN=immp2l PE=2 SV=1 27 172 7.0E-22
sp|Q8BPT6|IMP2L_MOUSE Mitochondrial inner membrane protease subunit 2 OS=Mus musculus GN=Immp2l PE=1 SV=1 29 172 2.0E-21
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9UST2|IMP2L_SCHPO Mitochondrial inner membrane protease subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC336.13c PE=3 SV=1 27 167 2.0E-27
sp|Q2KI92|IMP2L_BOVIN Mitochondrial inner membrane protease subunit 2 OS=Bos taurus GN=IMMP2L PE=2 SV=1 29 172 5.0E-22
sp|P46972|IMP2_YEAST Mitochondrial inner membrane protease subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP2 PE=1 SV=1 32 166 7.0E-22
sp|Q5PQ63|IMP2L_XENLA Mitochondrial inner membrane protease subunit 2 OS=Xenopus laevis GN=immp2l PE=2 SV=1 27 172 7.0E-22
sp|Q8BPT6|IMP2L_MOUSE Mitochondrial inner membrane protease subunit 2 OS=Mus musculus GN=Immp2l PE=1 SV=1 29 172 2.0E-21
sp|Q96T52|IMP2L_HUMAN Mitochondrial inner membrane protease subunit 2 OS=Homo sapiens GN=IMMP2L PE=2 SV=1 29 172 3.0E-21
sp|Q6AZD4|IMP2L_DANRE Mitochondrial inner membrane protease subunit 2 OS=Danio rerio GN=immp2l PE=2 SV=1 29 172 6.0E-20
sp|P08159|HDNO_ARTOX 6-hydroxy-D-nicotine oxidase OS=Arthrobacter oxydans PE=1 SV=2 256 419 4.0E-19
sp|D7UQ40|SOL5_ALTSO Bifunctional solanapyrone synthase OS=Alternaria solani GN=sol5 PE=1 SV=1 210 422 6.0E-16
sp|D4B1P2|A2372_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02372 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02372 PE=1 SV=1 256 430 9.0E-15
sp|Q96LU5|IMP1L_HUMAN Mitochondrial inner membrane protease subunit 1 OS=Homo sapiens GN=IMMP1L PE=2 SV=1 43 170 3.0E-14
sp|Q9CQU8|IMP1L_MOUSE Mitochondrial inner membrane protease subunit 1 OS=Mus musculus GN=Immp1l PE=1 SV=1 43 170 2.0E-13
sp|Q28I39|IMP1L_XENTR Mitochondrial inner membrane protease subunit 1 OS=Xenopus tropicalis GN=immp1l PE=2 SV=1 43 170 1.0E-12
sp|D4AS41|A7056_ARTBC Uncharacterized FAD-linked oxidoreductase ARB_02478 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_07056 PE=1 SV=2 251 401 1.0E-10
sp|P43485|MCRA_STRLA Mitomycin radical oxidase OS=Streptomyces lavendulae GN=mcrA PE=1 SV=2 232 558 1.0E-09
sp|O06997|YVDP_BACSU Uncharacterized FAD-linked oxidoreductase YvdP OS=Bacillus subtilis (strain 168) GN=yvdP PE=1 SV=1 256 446 2.0E-09
sp|Q54H55|Y8969_DICDI FAD-linked oxidoreductase DDB_G0289697 OS=Dictyostelium discoideum GN=DDB_G0289697 PE=2 SV=1 256 418 7.0E-09
sp|A6P6V9|CBDAS_CANSA Cannabidiolic acid synthase OS=Cannabis sativa GN=CBDAS PE=1 SV=1 250 468 1.0E-08
sp|O74800|IMP1_SCHPO Mitochondrial inner membrane protease subunit 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=imp1 PE=3 SV=1 43 166 2.0E-08
sp|Q8GTB6|THCAS_CANSA Tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=1 SV=1 250 472 7.0E-08
sp|P28627|IMP1_YEAST Mitochondrial inner membrane protease subunit 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=IMP1 PE=1 SV=3 40 160 3.0E-07
sp|Q796Y5|YGAK_BACSU Uncharacterized FAD-linked oxidoreductase YgaK OS=Bacillus subtilis (strain 168) GN=ygaK PE=3 SV=4 256 416 3.0E-06
sp|A6P6W0|CASL1_CANSA Cannabidiolic acid synthase-like 1 OS=Cannabis sativa GN=CBDAS2 PE=2 SV=1 250 468 5.0E-06
sp|A6P6W1|CASL2_CANSA Cannabidiolic acid synthase-like 2 OS=Cannabis sativa GN=CBDAS3 PE=2 SV=1 265 468 5.0E-06
sp|Q9FUJ3|CKX2_ARATH Cytokinin dehydrogenase 2 OS=Arabidopsis thaliana GN=CKX2 PE=1 SV=2 242 411 8.0E-06
sp|Q33DQ2|THCAI_CANSA Inactive tetrahydrocannabinolic acid synthase OS=Cannabis sativa PE=3 SV=1 250 472 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0050660 flavin adenine dinucleotide binding Yes
GO:0006465 signal peptide processing Yes
GO:0016491 oxidoreductase activity Yes
GO:0004252 serine-type endopeptidase activity Yes
GO:0140096 catalytic activity, acting on a protein No
GO:0008236 serine-type peptidase activity No
GO:0051604 protein maturation No
GO:0006508 proteolysis No
GO:0097159 organic cyclic compound binding No
GO:0016485 protein processing No
GO:0006518 peptide metabolic process No
GO:0008152 metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0044238 primary metabolic process No
GO:0017171 serine hydrolase activity No
GO:0044237 cellular metabolic process No
GO:0043168 anion binding No
GO:0006807 nitrogen compound metabolic process No
GO:0000166 nucleotide binding No
GO:0004175 endopeptidase activity No
GO:0043603 cellular amide metabolic process No
GO:0071704 organic substance metabolic process No
GO:0016787 hydrolase activity No
GO:0005488 binding No
GO:0008150 biological_process No
GO:0043170 macromolecule metabolic process No
GO:1901265 nucleoside phosphate binding No
GO:1901564 organonitrogen compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0019538 protein metabolic process No
GO:0008233 peptidase activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6542
MTLRSLWARRRLWRPRLGDAQTAALQLVGFATWIPLILWFNLHVAEVTWVDGGSMSPLLNGDRDTTLKRDAVLNF
KWAPQDGLKRGMVVTLRSPYRPESVVVKRVVALPGDVVLTKRPYSSPVQRVPPGHVWVEGDGPPGSSLDSNTYGP
VSMRLLTGRVTHILYPLRSYQQQPATYLTMKLAQSATLLLLLQTATAWTQWPKSGSLAQHTSNSIIEELGPLLSE
GATVVSPSWPEAAPLLDRAAYPRISPGYAAIVQVKTEQDVQQTIKYANRRHIPFLAVSGGHGWLSTLNRVQGGIQ
INMRYLNHTRLHADGKTVSVGGGTLQREVTAALFAKGKRAVTGICACVSVIAPLLGGGHSLLQGRYGFAADNLVS
AEVVLADGSIVTASADENADLFWGLRGAGHNLGIVTAFDVRVHDDGEHGWTSAVLVFTHEKLEAFLGVWNELEDR
YSDRGLLIMFAWVSRNDTVDGHRPVITMRMVSERDTPALADFLTAFRKLKPLQDSTSDLPWSEAQAAALDPRSCS
VNNNLMAFPNSFDRWDIAAMRRGFNLFADLVSDDAFAGSQWILESYGNKAVRQVPLSENAVPAEERRYDILTAFS
IVWEGQDDDRLLKARDMGNRMQEATRSADEPHHVYLNYAQGSEALQQVYGADEERLARLRELYCSETTYLSRKID
PEPSSTMDPPTETELQQDRKYFPPLSALPVKGQIDEPYYVSTDGVHYKPAIHWCFLGEIVQHSFHTRLRVLVRDR
AGKLVPIAFHTEDLGLGFLRSGEVKVGNTVAVLYAEKHDFGNSVVGICQKTKYNIKVLPGSLDNLKKLSKRLRMY
FEVSQGIPTCHNCHEKSTSLLRCDCQAVGWHEKGHKEDCKILRDSDFQGLLDLDWSRFDMFLEFADRS*
Coding >Ophun1|6542
ATGACCTTGAGGTCTTTATGGGCTCGTCGGCGGCTATGGCGTCCTCGACTCGGTGACGCTCAGACGGCGGCTCTA
CAGCTGGTCGGGTTCGCGACCTGGATACCGTTGATACTATGGTTTAACCTACATGTCGCCGAGGTCACCTGGGTG
GATGGAGGGTCGATGTCTCCGTTGCTCAATGGGGACCGGGACACGACATTGAAGAGAGACGCAGTTCTCAACTTC
AAATGGGCGCCGCAGGATGGACTGAAGAGGGGAATGGTGGTGACGCTGAGAAGCCCCTATCGTCCGGAGAGTGTG
GTGGTGAAGCGGGTGGTAGCTCTCCCCGGAGACGTCGTGTTGACGAAGCGGCCCTATTCGAGCCCGGTTCAAAGG
GTGCCGCCAGGGCACGTCTGGGTCGAGGGGGATGGGCCACCGGGATCGAGTTTGGACAGCAACACGTACGGACCC
GTGTCGATGAGGCTTCTTACGGGCAGGGTGACGCACATCTTGTATCCGCTTAGGAGCTACCAACAACAGCCAGCA
ACGTATCTGACGATGAAGCTCGCCCAATCTGCCACTCTGCTGCTGCTGCTTCAGACGGCAACAGCATGGACTCAG
TGGCCCAAATCTGGCTCTCTGGCCCAACATACAAGCAACTCCATCATCGAGGAGCTCGGCCCGCTGCTGTCCGAA
GGCGCGACAGTCGTGTCACCGTCTTGGCCCGAGGCAGCGCCACTGCTGGACCGCGCTGCCTATCCTCGCATCTCG
CCCGGCTACGCGGCCATTGTGCAGGTCAAGACGGAGCAGGATGTCCAGCAGACGATCAAGTACGCGAATCGGCGT
CATATCCCCTTTCTCGCGGTTTCGGGGGGCCACGGCTGGCTTTCAACTCTGAACCGGGTGCAAGGCGGCATTCAG
ATTAATATGCGGTACTTGAATCATACGAGGCTTCATGCGGATGGGAAGACGGTGAGTGTTGGGGGCGGTACTCTG
CAGCGTGAGGTGACGGCTGCATTGTTTGCCAAGGGGAAGCGTGCTGTGACGGGCATTTGTGCATGTGTCTCCGTC
ATCGCACCGCTTCTCGGCGGTGGCCATAGCCTGCTCCAGGGACGATACGGCTTCGCGGCCGATAACCTGGTTTCA
GCCGAGGTTGTTCTGGCCGACGGGAGCATCGTGACGGCCTCTGCGGATGAGAACGCGGATCTGTTCTGGGGGTTG
CGCGGCGCTGGACACAACTTGGGTATCGTGACGGCCTTTGACGTCCGGGTTCACGATGACGGCGAACATGGTTGG
ACCTCTGCTGTGCTGGTCTTTACCCATGAGAAGCTGGAGGCTTTCCTTGGGGTTTGGAACGAGCTTGAGGATAGG
TATAGTGATCGAGGGTTGCTGATTATGTTTGCCTGGGTGTCGCGGAATGACACGGTTGATGGTCATCGGCCAGTC
ATCACCATGCGTATGGTCTCGGAGAGAGACACACCCGCGCTGGCCGACTTCCTAACCGCCTTTCGAAAGCTGAAG
CCATTGCAGGACTCAACCTCAGATCTTCCCTGGAGCGAAGCCCAAGCCGCCGCCCTCGACCCTCGATCCTGCAGC
GTGAATAACAATCTCATGGCTTTTCCCAACTCGTTTGACCGGTGGGATATAGCAGCCATGCGGCGAGGCTTCAAC
CTCTTCGCCGACCTCGTGAGCGATGACGCCTTCGCGGGATCGCAGTGGATACTCGAATCGTACGGTAACAAGGCC
GTTCGCCAAGTTCCCCTTTCGGAGAATGCAGTACCGGCTGAGGAGCGGCGTTATGATATCCTCACTGCGTTTTCG
ATAGTCTGGGAGGGCCAAGATGACGATCGGCTGCTCAAGGCTCGGGATATGGGCAACAGGATGCAGGAGGCGACT
CGGAGCGCGGATGAGCCGCATCACGTCTATCTCAACTATGCGCAGGGGTCGGAGGCGTTGCAGCAGGTGTATGGC
GCTGATGAGGAGAGGCTTGCGAGGTTGAGGGAGCTATACTGCTCAGAGACAACCTACCTTTCAAGGAAAATCGAC
CCTGAGCCATCGTCAACCATGGACCCTCCCACCGAGACGGAACTGCAGCAGGACCGCAAATACTTCCCACCTCTA
TCCGCCCTCCCCGTCAAGGGCCAGATCGACGAGCCCTACTACGTCAGCACCGACGGCGTCCACTACAAGCCCGCC
ATCCACTGGTGCTTCCTCGGTGAGATTGTCCAGCATTCGTTCCATACGCGGCTCAGGGTTCTGGTTAGGGATCGG
GCTGGCAAGCTGGTGCCCATTGCTTTCCATACCGAAGACTTGGGGCTTGGGTTTTTGCGCAGCGGTGAGGTCAAG
GTTGGGAATACGGTTGCTGTTTTGTATGCTGAGAAGCATGACTTTGGCAACTCGGTTGTGGGTATCTGCCAGAAG
ACGAAGTACAACATCAAGGTACTCCCCGGATCGCTGGATAACCTCAAGAAGCTGAGCAAGAGGCTCCGAATGTAC
TTTGAAGTCAGCCAAGGCATTCCGACGTGCCACAACTGCCACGAAAAGTCGACCTCTCTGCTCCGCTGCGATTGC
CAGGCTGTGGGCTGGCATGAGAAGGGCCACAAGGAGGATTGCAAGATCTTGAGGGATTCTGACTTTCAGGGTCTG
TTGGATCTGGATTGGAGTCGCTTTGACATGTTTCTTGAGTTTGCGGACAGGTCGTGA
Transcript >Ophun1|6542
ATGACCTTGAGGTCTTTATGGGCTCGTCGGCGGCTATGGCGTCCTCGACTCGGTGACGCTCAGACGGCGGCTCTA
CAGCTGGTCGGGTTCGCGACCTGGATACCGTTGATACTATGGTTTAACCTACATGTCGCCGAGGTCACCTGGGTG
GATGGAGGGTCGATGTCTCCGTTGCTCAATGGGGACCGGGACACGACATTGAAGAGAGACGCAGTTCTCAACTTC
AAATGGGCGCCGCAGGATGGACTGAAGAGGGGAATGGTGGTGACGCTGAGAAGCCCCTATCGTCCGGAGAGTGTG
GTGGTGAAGCGGGTGGTAGCTCTCCCCGGAGACGTCGTGTTGACGAAGCGGCCCTATTCGAGCCCGGTTCAAAGG
GTGCCGCCAGGGCACGTCTGGGTCGAGGGGGATGGGCCACCGGGATCGAGTTTGGACAGCAACACGTACGGACCC
GTGTCGATGAGGCTTCTTACGGGCAGGGTGACGCACATCTTGTATCCGCTTAGGAGCTACCAACAACAGCCAGCA
ACGTATCTGACGATGAAGCTCGCCCAATCTGCCACTCTGCTGCTGCTGCTTCAGACGGCAACAGCATGGACTCAG
TGGCCCAAATCTGGCTCTCTGGCCCAACATACAAGCAACTCCATCATCGAGGAGCTCGGCCCGCTGCTGTCCGAA
GGCGCGACAGTCGTGTCACCGTCTTGGCCCGAGGCAGCGCCACTGCTGGACCGCGCTGCCTATCCTCGCATCTCG
CCCGGCTACGCGGCCATTGTGCAGGTCAAGACGGAGCAGGATGTCCAGCAGACGATCAAGTACGCGAATCGGCGT
CATATCCCCTTTCTCGCGGTTTCGGGGGGCCACGGCTGGCTTTCAACTCTGAACCGGGTGCAAGGCGGCATTCAG
ATTAATATGCGGTACTTGAATCATACGAGGCTTCATGCGGATGGGAAGACGGTGAGTGTTGGGGGCGGTACTCTG
CAGCGTGAGGTGACGGCTGCATTGTTTGCCAAGGGGAAGCGTGCTGTGACGGGCATTTGTGCATGTGTCTCCGTC
ATCGCACCGCTTCTCGGCGGTGGCCATAGCCTGCTCCAGGGACGATACGGCTTCGCGGCCGATAACCTGGTTTCA
GCCGAGGTTGTTCTGGCCGACGGGAGCATCGTGACGGCCTCTGCGGATGAGAACGCGGATCTGTTCTGGGGGTTG
CGCGGCGCTGGACACAACTTGGGTATCGTGACGGCCTTTGACGTCCGGGTTCACGATGACGGCGAACATGGTTGG
ACCTCTGCTGTGCTGGTCTTTACCCATGAGAAGCTGGAGGCTTTCCTTGGGGTTTGGAACGAGCTTGAGGATAGG
TATAGTGATCGAGGGTTGCTGATTATGTTTGCCTGGGTGTCGCGGAATGACACGGTTGATGGTCATCGGCCAGTC
ATCACCATGCGTATGGTCTCGGAGAGAGACACACCCGCGCTGGCCGACTTCCTAACCGCCTTTCGAAAGCTGAAG
CCATTGCAGGACTCAACCTCAGATCTTCCCTGGAGCGAAGCCCAAGCCGCCGCCCTCGACCCTCGATCCTGCAGC
GTGAATAACAATCTCATGGCTTTTCCCAACTCGTTTGACCGGTGGGATATAGCAGCCATGCGGCGAGGCTTCAAC
CTCTTCGCCGACCTCGTGAGCGATGACGCCTTCGCGGGATCGCAGTGGATACTCGAATCGTACGGTAACAAGGCC
GTTCGCCAAGTTCCCCTTTCGGAGAATGCAGTACCGGCTGAGGAGCGGCGTTATGATATCCTCACTGCGTTTTCG
ATAGTCTGGGAGGGCCAAGATGACGATCGGCTGCTCAAGGCTCGGGATATGGGCAACAGGATGCAGGAGGCGACT
CGGAGCGCGGATGAGCCGCATCACGTCTATCTCAACTATGCGCAGGGGTCGGAGGCGTTGCAGCAGGTGTATGGC
GCTGATGAGGAGAGGCTTGCGAGGTTGAGGGAGCTATACTGCTCAGAGACAACCTACCTTTCAAGGAAAATCGAC
CCTGAGCCATCGTCAACCATGGACCCTCCCACCGAGACGGAACTGCAGCAGGACCGCAAATACTTCCCACCTCTA
TCCGCCCTCCCCGTCAAGGGCCAGATCGACGAGCCCTACTACGTCAGCACCGACGGCGTCCACTACAAGCCCGCC
ATCCACTGGTGCTTCCTCGGTGAGATTGTCCAGCATTCGTTCCATACGCGGCTCAGGGTTCTGGTTAGGGATCGG
GCTGGCAAGCTGGTGCCCATTGCTTTCCATACCGAAGACTTGGGGCTTGGGTTTTTGCGCAGCGGTGAGGTCAAG
GTTGGGAATACGGTTGCTGTTTTGTATGCTGAGAAGCATGACTTTGGCAACTCGGTTGTGGGTATCTGCCAGAAG
ACGAAGTACAACATCAAGGTACTCCCCGGATCGCTGGATAACCTCAAGAAGCTGAGCAAGAGGCTCCGAATGTAC
TTTGAAGTCAGCCAAGGCATTCCGACGTGCCACAACTGCCACGAAAAGTCGACCTCTCTGCTCCGCTGCGATTGC
CAGGCTGTGGGCTGGCATGAGAAGGGCCACAAGGAGGATTGCAAGATCTTGAGGGATTCTGACTTTCAGGGTCTG
TTGGATCTGGATTGGAGTCGCTTTGACATGTTTCTTGAGTTTGCGGACAGGTCGTGA
Gene >Ophun1|6542
ATGACCTTGAGGTCTTTATGGGCTCGTCGGCGGCTATGGCGTCCTCGACTCGGTGACGCTCAGACGGCGGCTCTA
CAGCTGGTCGGGTTCGCGACCTGGATACCGTTGATACTATGGTTTAACCTACATGTCGCCGAGGTCACCTGGGTG
GATGGAGGGTCGATGTCTCCGTTGCTCAATGGGGACCGGGACACGACATTGAAGAGAGACGCAGTTCTCAACTTC
AAATGGGCGCCGCAGGATGGACTGAAGAGGGGAATGGTGGTGACGCTGAGGTGAGGGAGAGTCGGACTTGTCGAC
CCTGGGACGGACTGATGACGTTTCTCGACAGAAGCCCCTATCGTCCGGAGAGTGTGGTGGTGAAGCGGGTGGTAG
CTCTCCCCGGAGACGTCGTGTTGACGAAGCGGCCCTATTCGAGCCCGGTTCAAAGGGTGCCGCCAGGGCACGTCT
GGGTCGAGGGGGATGGGCCACCGGGATCGAGTTTGGACAGCAACACGTACGGACCCGTGTCGATGAGGCTTCTTA
CGGGCAGGGTGACGCACATCTTGTATCCGCTTAGGAGGTTTGGGCGTCTGCCGTGGCGGGAGTGGGATAGGCGAG
CTGATTATCAATGACGTTGCACTGCAGGCGGCTGAGATATGATGCGAGGTTTTTGGCGATGGCTTTGACCAGTTG
GGACATGTTGGGGCCTGCCTAATCTCATTCATCAGCAGACAAACGGTCTGATAATGGGTCTTTGGTGCCACGAAA
GCTGCGGAGAATAGCAGCCTAGGAGTAGCTGCTATCCTACAATGTATGTATATAGGAGCCGTGCCGCGATGTTTC
ATACTGAAGCTACCAACAACAGCCAGCAACGTATCTGACGATGAAGCTCGCCCAATCTGCCACTCTGCTGCTGCT
GCTTCAGACGGCAACAGCATGGACTCAGTGGCCCAAATCTGGCTCTCTGGCCCAACATACAAGCAACTCCATCAT
CGAGGAGCTCGGCCCGCTGCTGTCCGAAGGCGCGACAGTCGTGTCACCGTCTTGGCCCGAGGCAGCGCCACTGCT
GGACCGCGCTGCCTATCCTCGCATCTCGCCCGGCTACGCGGCCATTGTGCAGGTCAAGACGGAGCAGGATGTCCA
GCAGACGGTAGGGAGTTGGCTGCCAGTTGTGATGGAACAGAACGGGAGGCTGAAGGCCATGTCAGATCAAGTACG
CGAATCGGCGTCATATCCCCTTTCTCGCGGTTTCGGGGGGCCACGGCTGGCTTTCAACTCTGAACCGGGTGCAAG
GCGGCATTCAGATTAATATGCGGTACTTGAATCATACGAGGCTTCATGCGGATGGGAAGACGGTGAGTGTTGGGG
GCGGTACTCTGCAGCGTGAGGTGACGGCTGCATTGTTTGCCAAGGGGAAGCGTGCTGGTGAGTTGAGTCCCATGT
TGGAAGAGAGAAGGGAAAGACTGACGGGCATCAGTGACGGGCATTTGTGCATGTGTCTCCGTCATCGCACCGCTT
CTCGGCGGTGGCCATAGCCTGCTCCAGGGACGATACGGCTTCGCGGCCGATAACCTGGTTTCAGCCGAGGTTGTT
CTGGCCGACGGGAGCATCGTGACGGCCTCTGCGGATGAGAACGCGGATCTGTTCTGGGGGTTGCGCGGCGCTGGA
CACAACTTGGGTATCGTGACGGCCTTTGACGTCCGGGTTCACGATGACGGCGAACATGGTTGGACCTCTGCTGTG
CTGGTCTTTACCCATGAGAAGCTGGAGGCTTTCCTTGGGGTTTGGAACGAGCTTGAGGATAGGTATAGTGATCGA
GGGTTGCTGATTATGTTTGCCTGGGTGTCGCGGAATGACACGGTTGATGGTCATCGGGTGCGTTGTTTCTGTCCT
GTGCTTGCCATGAGGCTGACGGTGATTCCTTGACGAGCAGCCAGTCATCACCATGCGTATGGTCTCGGAGAGAGA
CACACCCGCGCTGGCCGACTTCCTAACCGCCTTTCGAAAGCTGAAGCCATTGCAGGACTCAACCTCAGATCTTCC
CTGGAGCGAAGCCCAAGCCGCCGCCCTCGACCCTCGATCCTGCAGCGTGAATAACAATCTCATGGCTTTTCCCAA
CTCGTTTGACCGGTGGGATATAGCAGCCATGCGGCGAGGCTTCAACCTCTTCGCCGACCTCGTGAGCGATGACGC
CTTCGCGGGATCGCAGTGGATACTCGAATCGTACGGTAACAAGGCCGTTCGCCAAGTTCCCCTTTCGGAGAATGC
AGTACCGGCTGAGGAGCGGCGTTATGATATCCTCACTGCGTTTTCGATAGTCTGGGAGGGCCAAGATGACGATCG
GCTGCTCAAGGCTCGGGATATGGGCAACAGGATGCAGGAGGCGACTCGGAGCGCGGATGAGCCGCATCACGTCTA
TCTCAACTATGCGCAGGGGTCGGAGGCGTTGCAGCAGGTGTATGGCGCTGATGAGGAGAGGCTTGCGAGGTTGAG
GGAGGTGAAGAGGCGGTATGATCCGCTGAATCGGTTTGGGTTTTATATGCCTTTATGAAAGAAGAGGATTAACTG
AGATGTCAGTTTCAACGAGAGCTCTCTACCTTGATAGCATCTCTTACCAGAATAGTCACAGTCTAAAGATATGTA
TGCGTCAACGTTTGGCTCCGTTACGCCTCCGTTTGCAATTTCCCTGCAGCCAACGGTTTCCCGTTTCGTCCATGT
CTGTCCGTTTAGGGACGCGTGAAATTTTCTATTGTTTATTTTTCGCAGCTGGTTTTCTGATCCTTGTTTTTTCTC
CCTCGTCACTTGATCGCCTCGCTGGTCAGGGGAGACGAACAAGACTGTTGATATCATCGTGGAAGCAACATCCCA
AGCTGATCAGCTCATAGCTATACTGCTCAGAGACAACCTACCTTTCAAGGAAAATCGACCCTGAGCCATCGTCAA
CCATGGACCCTCCCACCGAGACGGAACTGCAGCAGGACCGCAAATACTTCCCACCTCTATCCGCCCTCCCCGTCA
AGGGCCAGATCGACGAGCCCTACTACGTCAGCACCGACGGCGTCCACTACAAGCCCGCCATCCACTGGTGCTTCC
TCGGTGAGATTGTCCAGCATTCGTTCCATACGCGGCTCAGGGTTCTGGTTAGGGATCGGGCTGGCAAGCTGGTGC
CCATTGCTTTCCATACCGAAGACTTGGGGCTTGGGTTTTTGCGCAGCGGTGAGGTCAAGGTTGGGAATACGGTTG
CTGTTTTGTATGCTGAGAAGCATGACTTTGGCAACTCGGTTGTGGGTATCTGCCAGAAGACGAAGTACAACATCA
AGGTGAGCATCTCTATGTTCTTTTAGCTTCTCTTGTTGCTAACATCTTGGGGAACAGGTACTCCCCGGATCGCTG
GATAACCTCAAGAAGCTGAGCAAGAGGCTCCGAATGTACTTTGAAGTCAGCCAAGGCATTCCGACGTGCCACAAC
TGCCACGAAAAGTCGACCTCTCTGCTCCGCTGCGTGAAATGCGAGATGTTTCACTACTGCAACAAGGCGAGTCAT
CATCCTCTCTGGTGATTGATGCGTTGCTGACTGGTGGCGTGTAGGATTGCCAGGCTGTGGGCTGGCATGAGAAGG
GCCACAAGGAGGATTGCAAGATCTTGAGGGATTCTGACTTTCAGGGTCTGTTGGATCTGGATTGGAGTCGCTTTG
ACATGTTTCTTGAGTTTGCGGACAGGTCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail