Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6538
Gene name
LocationContig_72:17878..19166
Strand+
Gene length (bp)1288
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00535 Glycos_transf_2 Glycosyl transferase family 2 1.1E-22 91 225
PF13641 Glyco_tranf_2_3 Glycosyltransferase like family 2 5.6E-07 141 208

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60061|ALG5_SCHPO Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg5 PE=3 SV=1 17 380 2.0E-78
sp|P40350|ALG5_YEAST Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG5 PE=1 SV=1 38 379 8.0E-77
sp|Q54J42|ALG5_DICDI Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum GN=alg5 PE=2 SV=1 87 379 8.0E-56
sp|Q9VLQ1|ALG5_DROME Dolichyl-phosphate beta-glucosyltransferase OS=Drosophila melanogaster GN=wol PE=1 SV=1 88 379 1.0E-53
sp|Q9Y673|ALG5_HUMAN Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens GN=ALG5 PE=1 SV=1 90 379 2.0E-51
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60061|ALG5_SCHPO Dolichyl-phosphate beta-glucosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=alg5 PE=3 SV=1 17 380 2.0E-78
sp|P40350|ALG5_YEAST Dolichyl-phosphate beta-glucosyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ALG5 PE=1 SV=1 38 379 8.0E-77
sp|Q54J42|ALG5_DICDI Dolichyl-phosphate beta-glucosyltransferase OS=Dictyostelium discoideum GN=alg5 PE=2 SV=1 87 379 8.0E-56
sp|Q9VLQ1|ALG5_DROME Dolichyl-phosphate beta-glucosyltransferase OS=Drosophila melanogaster GN=wol PE=1 SV=1 88 379 1.0E-53
sp|Q9Y673|ALG5_HUMAN Dolichyl-phosphate beta-glucosyltransferase OS=Homo sapiens GN=ALG5 PE=1 SV=1 90 379 2.0E-51
sp|A2ELE6|ALG5C_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5C OS=Trichomonas vaginalis GN=ALG5C PE=1 SV=1 85 378 2.0E-51
sp|A2EK20|ALG5B_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5B OS=Trichomonas vaginalis GN=ALG5B PE=1 SV=1 18 366 1.0E-50
sp|Q9DB25|ALG5_MOUSE Dolichyl-phosphate beta-glucosyltransferase OS=Mus musculus GN=Alg5 PE=1 SV=1 90 379 1.0E-49
sp|A2DZE8|ALG5A_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5A OS=Trichomonas vaginalis GN=ALG5A PE=1 SV=1 48 381 9.0E-42
sp|A2E3C6|ALG5D_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5D OS=Trichomonas vaginalis GN=ALG5D PE=1 SV=1 13 381 2.0E-41
sp|A2DSR8|ALG5E_TRIVA Dolichyl-phosphate beta-glucosyltransferase ALG5E OS=Trichomonas vaginalis GN=ALG5E PE=1 SV=1 83 366 1.0E-39
sp|D4GUA0|AGLD_HALVD Glycosyltransferase AglD OS=Haloferax volcanii (strain ATCC 29605 / DSM 3757 / JCM 8879 / NBRC 14742 / NCIMB 2012 / VKM B-1768 / DS2) GN=aglD PE=1 SV=1 90 380 2.0E-17
sp|A5GFZ5|DPM1_PIG Dolichol-phosphate mannosyltransferase subunit 1 OS=Sus scrofa GN=DPM1 PE=3 SV=1 135 326 5.0E-11
sp|O60762|DPM1_HUMAN Dolichol-phosphate mannosyltransferase subunit 1 OS=Homo sapiens GN=DPM1 PE=1 SV=1 135 326 2.0E-10
sp|O70152|DPM1_MOUSE Dolichol-phosphate mannosyltransferase subunit 1 OS=Mus musculus GN=Dpm1 PE=1 SV=1 135 314 2.0E-10
sp|Q1JQ93|DPM1_BOVIN Dolichol-phosphate mannosyltransferase subunit 1 OS=Bos taurus GN=DPM1 PE=2 SV=1 135 326 2.0E-10
sp|Q9WU83|DPM1_CRIGR Dolichol-phosphate mannosyltransferase subunit 1 OS=Cricetulus griseus GN=DPM1 PE=2 SV=1 135 326 3.0E-10
sp|Q9VIU7|DPM1_DROME Probable dolichol-phosphate mannosyltransferase OS=Drosophila melanogaster GN=CG10166 PE=3 SV=1 135 372 1.0E-09
sp|O14466|DPM1_SCHPO Dolichol-phosphate mannosyltransferase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dpm1 PE=2 SV=1 91 311 2.0E-07
sp|C5BDQ5|ARNC_EDWI9 Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase OS=Edwardsiella ictaluri (strain 93-146) GN=arnC PE=3 SV=1 89 231 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 37 0.5

Transmembrane Domains

Domain # Start End Length
1 13 35 22

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6538
MECLRQLAAPKNLALGCVLGLLILFSLFLLLHLVAPKPRPVRSSEKTYVTSSPGGTETRRLPCWYDRWLAERRLD
ESAASDDMEPAELLLSVIFPAYNEEKRIIPTLEEAVAYLDEHVGRNPQPETTASPEGKRVKALSGPDSGYEILVV
DDGSSDGTVDVVLEFARSHELHDVLRVVSLASNRGKGGGVTHGLRHVRGAYALFADADGASRFSDVGKLVEGVDR
VADGSGRGVAIGSRAHLVGSEAVVKRSALRNFLMRSFHLVLTILTPPATSRLRDTQCGFKLFTRPSLAHIVPYMH
AEGWIFDIEMLMLAESAPAVPVRAADGSVIGSSPGIKVAEVPVEWHEVGGSKLNVVQDSVKMAVGLAVLRASWML
GVYRRRVP*
Coding >Ophun1|6538
ATGGAGTGCCTGCGGCAGCTCGCCGCGCCCAAGAACCTCGCCCTCGGCTGCGTTCTAGGACTCCTCATTCTCTTC
AGCCTCTTCCTCCTTTTGCACCTCGTCGCGCCCAAACCGCGGCCCGTTCGATCTTCGGAGAAGACGTATGTCACG
TCTAGTCCTGGGGGAACGGAGACGCGCAGGTTGCCCTGCTGGTACGACCGCTGGCTTGCCGAGCGACGACTGGAT
GAGTCGGCGGCGTCGGACGACATGGAGCCGGCAGAGCTGCTCCTCAGCGTCATATTCCCAGCCTACAACGAGGAG
AAGCGCATTATTCCCACTCTAGAGGAGGCAGTTGCCTACCTAGACGAGCACGTCGGGCGAAACCCACAGCCCGAG
ACAACCGCCAGCCCCGAAGGAAAACGAGTCAAGGCCCTCTCAGGTCCCGACAGCGGGTACGAAATCCTCGTGGTC
GATGACGGCAGCAGCGACGGCACCGTCGATGTGGTCCTCGAGTTTGCTCGCAGTCATGAGCTTCATGATGTTCTT
CGTGTTGTCTCTCTGGCCAGCAATAGGGGCAAGGGGGGTGGCGTGACGCATGGATTGCGGCACGTTCGCGGCGCG
TACGCTCTCTTCGCCGATGCGGACGGCGCTTCACGCTTCAGTGACGTCGGGAAGCTCGTCGAGGGCGTCGACCGC
GTCGCCGACGGGTCCGGTCGAGGCGTGGCCATCGGAAGCCGAGCACACCTCGTCGGCAGCGAGGCGGTAGTCAAG
CGCTCCGCTCTCCGCAACTTCCTCATGCGCTCCTTTCACCTCGTTCTCACCATCCTAACCCCCCCAGCAACATCC
CGCCTCCGCGACACCCAATGCGGCTTCAAGCTCTTCACGCGGCCCTCCCTCGCCCACATCGTCCCCTACATGCAC
GCCGAAGGCTGGATCTTCGACATCGAGATGCTGATGCTAGCCGAGTCGGCGCCCGCCGTCCCCGTCCGCGCCGCC
GACGGCTCCGTCATCGGCTCCAGCCCCGGCATTAAGGTCGCCGAGGTTCCCGTCGAGTGGCATGAGGTTGGGGGC
AGCAAGCTCAACGTCGTGCAGGATAGCGTCAAGATGGCGGTTGGCTTGGCGGTTTTGCGGGCCAGTTGGATGCTC
GGCGTTTATCGCAGGAGGGTTCCTTGA
Transcript >Ophun1|6538
ATGGAGTGCCTGCGGCAGCTCGCCGCGCCCAAGAACCTCGCCCTCGGCTGCGTTCTAGGACTCCTCATTCTCTTC
AGCCTCTTCCTCCTTTTGCACCTCGTCGCGCCCAAACCGCGGCCCGTTCGATCTTCGGAGAAGACGTATGTCACG
TCTAGTCCTGGGGGAACGGAGACGCGCAGGTTGCCCTGCTGGTACGACCGCTGGCTTGCCGAGCGACGACTGGAT
GAGTCGGCGGCGTCGGACGACATGGAGCCGGCAGAGCTGCTCCTCAGCGTCATATTCCCAGCCTACAACGAGGAG
AAGCGCATTATTCCCACTCTAGAGGAGGCAGTTGCCTACCTAGACGAGCACGTCGGGCGAAACCCACAGCCCGAG
ACAACCGCCAGCCCCGAAGGAAAACGAGTCAAGGCCCTCTCAGGTCCCGACAGCGGGTACGAAATCCTCGTGGTC
GATGACGGCAGCAGCGACGGCACCGTCGATGTGGTCCTCGAGTTTGCTCGCAGTCATGAGCTTCATGATGTTCTT
CGTGTTGTCTCTCTGGCCAGCAATAGGGGCAAGGGGGGTGGCGTGACGCATGGATTGCGGCACGTTCGCGGCGCG
TACGCTCTCTTCGCCGATGCGGACGGCGCTTCACGCTTCAGTGACGTCGGGAAGCTCGTCGAGGGCGTCGACCGC
GTCGCCGACGGGTCCGGTCGAGGCGTGGCCATCGGAAGCCGAGCACACCTCGTCGGCAGCGAGGCGGTAGTCAAG
CGCTCCGCTCTCCGCAACTTCCTCATGCGCTCCTTTCACCTCGTTCTCACCATCCTAACCCCCCCAGCAACATCC
CGCCTCCGCGACACCCAATGCGGCTTCAAGCTCTTCACGCGGCCCTCCCTCGCCCACATCGTCCCCTACATGCAC
GCCGAAGGCTGGATCTTCGACATCGAGATGCTGATGCTAGCCGAGTCGGCGCCCGCCGTCCCCGTCCGCGCCGCC
GACGGCTCCGTCATCGGCTCCAGCCCCGGCATTAAGGTCGCCGAGGTTCCCGTCGAGTGGCATGAGGTTGGGGGC
AGCAAGCTCAACGTCGTGCAGGATAGCGTCAAGATGGCGGTTGGCTTGGCGGTTTTGCGGGCCAGTTGGATGCTC
GGCGTTTATCGCAGGAGGGTTCCTTGA
Gene >Ophun1|6538
ATGGAGTGCCTGCGGCAGCTCGCCGCGCCCAAGAACCTCGCCCTCGGCTGCGTTCTAGGACTCCTCATTCTCTTC
AGCGTACGAAGCCGTCTCACTCGTCCCCTCCGTCAAGCCATTTCCCCAGACTGACGGGGGAACAAACGCAGCTCT
TCCTCCTTTTGCACCTCGTCGCGCCCAAACCGCGGCCCGTTCGATCTTCGGAGAAGACGTATGTCACGTCTAGTC
CTGGGGGAACGGAGACGCGCAGGTTGCCCTGCTGGTACGACCGCTGGCTTGCCGAGCGACGACTGGATGAGTCGG
CGGCGTCGGACGACATGGAGCCGGCAGAGCTGCTCCTCAGCGTCATATTCCCAGCCTACAACGAGGAGAAGCGCA
TTATTCCCACTCTAGAGGAGGCAGTTGCCTACCTAGACGAGCACGTCGGGCGAAACCCACAGCCCGAGACAACCG
CCAGCCCCGAAGGAAAACGAGTCAAGGCCCTCTCAGGTCCCGACAGCGGGTACGAAATCCTCGTGGTCGATGACG
GCAGCAGCGACGGCACCGTCGATGTGGTCCTCGAGTTTGCTCGCAGTCATGAGCTTCATGATGTTCTTCGTGTTG
TCTCTCTGGCCAGCAATAGGGGCAAGGGGGGTGGCGTGACGCATGGATTGCGGCACGTTCGCGGCGCGTACGCTC
TCTTCGCCGATGCGGACGGCGCTTCACGCTTCAGTGACGTCGGGAAGCTCGTCGAGGGCGTCGACCGCGTCGCCG
ACGGGTCCGGTCGAGGCGTGGCCATCGGAAGCCGAGCACACCTCGTCGGCAGCGAGGCGGTAGTCAAGGTACAGC
CCGCCAAAAGAACCCATCAGCATCCAACCCGGAGCCAAAACTAACCCAGAGAAACCTCAAGCGCTCCGCTCTCCG
CAACTTCCTCATGCGCTCCTTTCACCTCGTTCTCACCATCCTAACCCCCCCAGCAACATCCCGCCTCCGCGACAC
CCAATGCGGCTTCAAGCTCTTCACGCGGCCCTCCCTCGCCCACATCGTCCCCTACATGCACGCCGAAGGCTGGAT
CTTCGACATCGAGATGCTGATGCTAGCCGAGTCGGCGCCCGCCGTCCCCGTCCGCGCCGCCGACGGCTCCGTCAT
CGGCTCCAGCCCCGGCATTAAGGTCGCCGAGGTTCCCGTCGAGTGGCATGAGGTTGGGGGCAGCAAGCTCAACGT
CGTGCAGGATAGCGTCAAGATGGCGGTTGGCTTGGCGGTTTTGCGGGCCAGTTGGATGCTCGGCGTTTATCGCAG
GAGGGTTCCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail