Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6536
Gene name
LocationContig_72:10126..12981
Strand-
Gene length (bp)2855
Transcript length (bp)2460
Coding sequence length (bp)2460
Protein length (aa) 820

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04802 PP4R3 Phosphatase 4 regulatory subunit 3 8.5E-84 141 329

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7J8|YGL1_SCHPO Uncharacterized protein C216.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC216.01c PE=2 SV=3 14 619 4.0E-128
sp|Q922R5|P4R3B_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Mus musculus GN=Ppp4r3b PE=1 SV=2 13 730 1.0E-100
sp|Q4S6U8|PP4R3_TETNG Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Tetraodon nigroviridis GN=smek1 PE=3 SV=1 13 684 9.0E-100
sp|Q5SP90|PP4R3_DANRE Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Danio rerio GN=smek1 PE=1 SV=1 13 674 1.0E-98
sp|Q7ZX60|P4R3A_XENLA Serine/threonine-protein phosphatase 4 regulatory subunit 3-A OS=Xenopus laevis GN=ppp4r3b-a PE=2 SV=1 13 676 3.0E-98
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7J8|YGL1_SCHPO Uncharacterized protein C216.01c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC216.01c PE=2 SV=3 14 619 4.0E-128
sp|Q922R5|P4R3B_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Mus musculus GN=Ppp4r3b PE=1 SV=2 13 730 1.0E-100
sp|Q4S6U8|PP4R3_TETNG Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Tetraodon nigroviridis GN=smek1 PE=3 SV=1 13 684 9.0E-100
sp|Q5SP90|PP4R3_DANRE Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Danio rerio GN=smek1 PE=1 SV=1 13 674 1.0E-98
sp|Q7ZX60|P4R3A_XENLA Serine/threonine-protein phosphatase 4 regulatory subunit 3-A OS=Xenopus laevis GN=ppp4r3b-a PE=2 SV=1 13 676 3.0E-98
sp|Q801Q7|P4R3B_XENLA Serine/threonine-protein phosphatase 4 regulatory subunit 3-B OS=Xenopus laevis GN=ppp4r3b-b PE=2 SV=1 13 676 2.0E-97
sp|Q6DFT3|PP4R3_XENTR Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Xenopus tropicalis GN=ppp4r3b PE=2 SV=1 13 620 3.0E-97
sp|Q6P2K6|P4R3A_MOUSE Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Mus musculus GN=Ppp4r3a PE=1 SV=1 13 686 1.0E-96
sp|Q6INN7|PP4R3_XENLA Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Xenopus laevis GN=smek1 PE=2 SV=1 13 674 2.0E-95
sp|Q6IN85|P4R3A_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 3A OS=Homo sapiens GN=PPP4R3A PE=1 SV=1 13 686 9.0E-95
sp|Q9VFS5|PP4R3_DROME Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Drosophila melanogaster GN=flfl PE=1 SV=4 13 622 1.0E-91
sp|Q54I18|SMEK_DICDI Suppressor of Mek1 OS=Dictyostelium discoideum GN=smkA PE=1 SV=1 13 622 1.0E-87
sp|Q3V0Y1|SMEK3_MOUSE Putative SMEK homolog 3 OS=Mus musculus GN=Ppp4r3cp PE=5 SV=2 44 619 4.0E-78
sp|Q6ZMV5|SMEK3_HUMAN Putative SMEK homolog 3 OS=Homo sapiens GN=PPP4R3CP PE=5 SV=2 13 619 6.0E-77
sp|Q5MIZ7|P4R3B_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Homo sapiens GN=PPP4R3B PE=1 SV=2 13 501 5.0E-69
sp|Q6FR44|PP4R3_CANGA Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=PSY2 PE=3 SV=1 11 588 4.0E-67
sp|P40164|PP4R3_YEAST Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PSY2 PE=1 SV=1 11 585 4.0E-66
sp|Q6CQ91|PP4R3_KLULA Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=PSY2 PE=3 SV=1 11 579 9.0E-64
sp|Q75E32|PP4R3_ASHGO Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSY2 PE=3 SV=2 10 369 2.0E-54
sp|Q5MIZ7|P4R3B_HUMAN Serine/threonine-protein phosphatase 4 regulatory subunit 3B OS=Homo sapiens GN=PPP4R3B PE=1 SV=2 493 731 1.0E-20
sp|Q75E32|PP4R3_ASHGO Serine/threonine-protein phosphatase 4 regulatory subunit 3 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=PSY2 PE=3 SV=2 399 616 3.0E-13
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup1884
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7929
Ophiocordyceps australis map64 (Brazil) OphauB2|5858
Ophiocordyceps camponoti-floridani Ophcf2|02837
Ophiocordyceps camponoti-rufipedis Ophun1|6536 (this protein)
Ophiocordyceps kimflemingae Ophio5|7957
Ophiocordyceps subramaniannii Hirsu2|1933

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6536
MMAQPVPHQATDKRRVKVYELRNNDWFDRGTGFCTATYNPVKTLIVWQEPGSGVDMALSFQEAEGCGMIWRFVNR
IQQSLLHNTPIVDDGLDDELAVEAAPTVVSLPPADLGNLADIEMTMRNMTASTDGRDSLAKAVMEEGYIGKLIPL
VEIAEDLESLPDLHRLCNIMKTILLLNDTSIIERAVSDECVLGVVGALEYDPDFPSHKANHRLWLDNEGRFKEVV
PIKDNKTREKIHQTYRLQYLKDVVLARILDDPTFSVLNSLIFFNQVDIVQHLQSNTAFLSDLFGIFNSRRRDQEK
RKEAVLFIQQCCAIAKNIQPPARQMLYNNFIAHGLLSVIHFGLRHTDVAVRVGATDILISIIDHDPQMIRQTIYR
QMHDNQPGLTDSLIDLLLVEVDLGVKSQIGEALKVLLDQGMVPQGPEQLVKTNGEMPGRPRPQSSLDPQQELFLT
RFYERSAPKLFQPLLDLESRTDMNLSVHQASMYTCLVEILDFFIRQHHRFSRYLVLNNNLAQCVCQLLKSPEKYI
QLAAIRFFRHLIGNQEEFYMKHLTEKNVLGPILNVVVETLPRDNLLSSASLELFDYIRKESIVEMIKHLVVNFRE
RLVSLSYLPTFRDMVQRYDHTQGFTVNIEYVLEGENDFARRPPPNARLMEQIVVDPVEEEYWNTSDPDDEDDDED
GRETTAIKTPSTNGAGTPSKPLVDYQSDDDSDDSVNTEAARDDDDVGPSPESGTSPVSTEVAPPLERISEKRRRE
EDEEDELGKLLQSKRRSKTATDGTANAMRKAQRRKSFTPHAGTGPPRKIAISLSPSAKAGLDEKQQEQS*
Coding >Ophun1|6536
ATGATGGCACAGCCCGTGCCTCATCAGGCCACGGACAAGCGGCGCGTCAAGGTCTACGAGCTTCGCAATAACGAC
TGGTTCGATCGAGGCACCGGCTTTTGCACCGCGACTTACAATCCTGTAAAGACGTTGATTGTATGGCAAGAACCG
GGCAGCGGCGTCGACATGGCCCTGAGCTTCCAGGAAGCCGAGGGATGTGGGATGATATGGCGGTTCGTCAACAGA
ATCCAGCAGTCCTTGCTTCACAACACTCCCATCGTCGATGATGGCCTCGACGATGAGCTTGCCGTCGAGGCGGCT
CCCACCGTCGTCAGCCTCCCGCCCGCCGATCTGGGCAACCTGGCCGATATCGAAATGACCATGCGCAACATGACG
GCATCGACTGACGGCCGCGACTCTCTGGCCAAGGCCGTCATGGAGGAAGGATACATCGGAAAGCTCATACCCTTG
GTCGAGATCGCCGAGGACCTCGAGAGCCTCCCCGACCTGCACCGGCTGTGCAACATCATGAAGACGATTCTGCTC
CTCAACGACACCAGCATCATCGAACGTGCCGTCTCGGACGAGTGCGTGCTGGGCGTCGTCGGCGCGCTCGAGTAC
GATCCAGACTTTCCCAGCCACAAGGCGAACCACCGGCTTTGGCTGGACAACGAGGGGCGCTTCAAGGAGGTGGTT
CCCATCAAGGACAACAAGACGCGCGAAAAGATACACCAGACGTATCGCCTGCAGTACCTCAAGGATGTTGTTCTC
GCCCGCATTCTCGATGATCCCACCTTTTCCGTCCTCAACTCGCTCATCTTCTTCAACCAGGTCGACATTGTTCAG
CACCTGCAGTCCAACACGGCTTTTCTCAGCGACCTCTTTGGCATCTTCAACTCGCGCCGCCGCGATCAGGAGAAG
CGCAAGGAGGCCGTCCTCTTTATCCAGCAGTGCTGCGCCATCGCCAAGAACATTCAACCGCCCGCGCGCCAGATG
CTCTACAACAACTTCATCGCCCACGGCCTGCTCTCCGTCATCCACTTTGGCTTGCGGCATACCGACGTCGCTGTT
CGCGTCGGGGCCACCGACATCTTGATATCCATCATCGATCACGACCCGCAGATGATCCGGCAGACGATTTACCGG
CAGATGCACGACAACCAGCCGGGCCTGACGGACTCGCTCATCGACCTCTTGCTGGTCGAGGTGGACCTGGGCGTC
AAGTCGCAGATCGGGGAGGCGCTCAAGGTGCTGCTGGACCAGGGCATGGTGCCCCAGGGGCCCGAACAGCTAGTA
AAGACCAATGGCGAGATGCCAGGCCGGCCGAGACCGCAGTCGTCGCTGGATCCTCAGCAGGAGCTGTTCCTGACG
CGTTTCTACGAACGATCCGCCCCGAAACTGTTCCAACCGCTGCTCGACCTCGAGAGCCGGACCGACATGAATCTG
TCGGTGCACCAGGCGTCCATGTATACGTGTCTTGTGGAGATTCTCGACTTCTTCATCCGCCAGCATCATCGCTTC
AGCCGTTACCTTGTCCTGAACAACAACCTCGCCCAGTGCGTCTGTCAGCTTCTCAAGAGCCCAGAGAAGTATATA
CAGCTAGCCGCCATCCGCTTCTTCCGCCACCTGATCGGTAACCAGGAAGAGTTCTACATGAAGCATCTGACGGAG
AAGAACGTGCTCGGACCCATTCTCAACGTCGTCGTCGAGACGCTACCGCGAGACAACCTGCTGAGCTCGGCGTCG
CTTGAGCTATTCGACTATATTCGTAAGGAGTCTATTGTCGAAATGATCAAGCACCTCGTCGTCAACTTCCGGGAG
CGGCTGGTCAGCCTCAGCTACCTGCCAACGTTCCGGGACATGGTCCAGCGGTACGACCACACGCAGGGCTTCACC
GTCAACATCGAGTACGTGCTCGAGGGCGAAAACGACTTTGCTCGGCGGCCACCGCCCAACGCGCGGTTGATGGAG
CAAATCGTGGTCGATCCCGTCGAGGAGGAGTACTGGAACACGTCGGACCCGGACGACGAAGACGACGACGAAGAC
GGACGCGAGACCACAGCCATCAAGACGCCATCGACCAACGGAGCCGGCACGCCGTCGAAGCCGCTGGTGGACTAT
CAATCAGACGACGACAGCGACGACAGCGTCAACACCGAGGCAGCCAGAGACGACGACGACGTCGGCCCCAGTCCC
GAGAGCGGCACCTCGCCCGTCAGCACGGAGGTGGCGCCACCACTAGAGCGGATATCAGAGAAGCGACGACGAGAG
GAGGACGAGGAAGACGAGCTGGGAAAGCTGCTCCAGAGCAAGCGCCGCAGCAAGACGGCCACCGACGGCACCGCA
AACGCCATGCGCAAGGCACAGCGACGGAAGAGCTTCACGCCCCACGCAGGAACCGGCCCGCCAAGGAAAATCGCA
ATCAGCCTCTCCCCATCCGCGAAAGCAGGCCTCGACGAGAAGCAACAAGAGCAATCCTGA
Transcript >Ophun1|6536
ATGATGGCACAGCCCGTGCCTCATCAGGCCACGGACAAGCGGCGCGTCAAGGTCTACGAGCTTCGCAATAACGAC
TGGTTCGATCGAGGCACCGGCTTTTGCACCGCGACTTACAATCCTGTAAAGACGTTGATTGTATGGCAAGAACCG
GGCAGCGGCGTCGACATGGCCCTGAGCTTCCAGGAAGCCGAGGGATGTGGGATGATATGGCGGTTCGTCAACAGA
ATCCAGCAGTCCTTGCTTCACAACACTCCCATCGTCGATGATGGCCTCGACGATGAGCTTGCCGTCGAGGCGGCT
CCCACCGTCGTCAGCCTCCCGCCCGCCGATCTGGGCAACCTGGCCGATATCGAAATGACCATGCGCAACATGACG
GCATCGACTGACGGCCGCGACTCTCTGGCCAAGGCCGTCATGGAGGAAGGATACATCGGAAAGCTCATACCCTTG
GTCGAGATCGCCGAGGACCTCGAGAGCCTCCCCGACCTGCACCGGCTGTGCAACATCATGAAGACGATTCTGCTC
CTCAACGACACCAGCATCATCGAACGTGCCGTCTCGGACGAGTGCGTGCTGGGCGTCGTCGGCGCGCTCGAGTAC
GATCCAGACTTTCCCAGCCACAAGGCGAACCACCGGCTTTGGCTGGACAACGAGGGGCGCTTCAAGGAGGTGGTT
CCCATCAAGGACAACAAGACGCGCGAAAAGATACACCAGACGTATCGCCTGCAGTACCTCAAGGATGTTGTTCTC
GCCCGCATTCTCGATGATCCCACCTTTTCCGTCCTCAACTCGCTCATCTTCTTCAACCAGGTCGACATTGTTCAG
CACCTGCAGTCCAACACGGCTTTTCTCAGCGACCTCTTTGGCATCTTCAACTCGCGCCGCCGCGATCAGGAGAAG
CGCAAGGAGGCCGTCCTCTTTATCCAGCAGTGCTGCGCCATCGCCAAGAACATTCAACCGCCCGCGCGCCAGATG
CTCTACAACAACTTCATCGCCCACGGCCTGCTCTCCGTCATCCACTTTGGCTTGCGGCATACCGACGTCGCTGTT
CGCGTCGGGGCCACCGACATCTTGATATCCATCATCGATCACGACCCGCAGATGATCCGGCAGACGATTTACCGG
CAGATGCACGACAACCAGCCGGGCCTGACGGACTCGCTCATCGACCTCTTGCTGGTCGAGGTGGACCTGGGCGTC
AAGTCGCAGATCGGGGAGGCGCTCAAGGTGCTGCTGGACCAGGGCATGGTGCCCCAGGGGCCCGAACAGCTAGTA
AAGACCAATGGCGAGATGCCAGGCCGGCCGAGACCGCAGTCGTCGCTGGATCCTCAGCAGGAGCTGTTCCTGACG
CGTTTCTACGAACGATCCGCCCCGAAACTGTTCCAACCGCTGCTCGACCTCGAGAGCCGGACCGACATGAATCTG
TCGGTGCACCAGGCGTCCATGTATACGTGTCTTGTGGAGATTCTCGACTTCTTCATCCGCCAGCATCATCGCTTC
AGCCGTTACCTTGTCCTGAACAACAACCTCGCCCAGTGCGTCTGTCAGCTTCTCAAGAGCCCAGAGAAGTATATA
CAGCTAGCCGCCATCCGCTTCTTCCGCCACCTGATCGGTAACCAGGAAGAGTTCTACATGAAGCATCTGACGGAG
AAGAACGTGCTCGGACCCATTCTCAACGTCGTCGTCGAGACGCTACCGCGAGACAACCTGCTGAGCTCGGCGTCG
CTTGAGCTATTCGACTATATTCGTAAGGAGTCTATTGTCGAAATGATCAAGCACCTCGTCGTCAACTTCCGGGAG
CGGCTGGTCAGCCTCAGCTACCTGCCAACGTTCCGGGACATGGTCCAGCGGTACGACCACACGCAGGGCTTCACC
GTCAACATCGAGTACGTGCTCGAGGGCGAAAACGACTTTGCTCGGCGGCCACCGCCCAACGCGCGGTTGATGGAG
CAAATCGTGGTCGATCCCGTCGAGGAGGAGTACTGGAACACGTCGGACCCGGACGACGAAGACGACGACGAAGAC
GGACGCGAGACCACAGCCATCAAGACGCCATCGACCAACGGAGCCGGCACGCCGTCGAAGCCGCTGGTGGACTAT
CAATCAGACGACGACAGCGACGACAGCGTCAACACCGAGGCAGCCAGAGACGACGACGACGTCGGCCCCAGTCCC
GAGAGCGGCACCTCGCCCGTCAGCACGGAGGTGGCGCCACCACTAGAGCGGATATCAGAGAAGCGACGACGAGAG
GAGGACGAGGAAGACGAGCTGGGAAAGCTGCTCCAGAGCAAGCGCCGCAGCAAGACGGCCACCGACGGCACCGCA
AACGCCATGCGCAAGGCACAGCGACGGAAGAGCTTCACGCCCCACGCAGGAACCGGCCCGCCAAGGAAAATCGCA
ATCAGCCTCTCCCCATCCGCGAAAGCAGGCCTCGACGAGAAGCAACAAGAGCAATCCTGA
Gene >Ophun1|6536
ATGATGGCACAGCCCGTGCCTCATCAGGCCACGGACAAGCGGCGCGTCAAGGTCTACGAGCTTCGCAATAACGAC
TGGTTCGATCGAGGCACCGGCTTTTGCACCGCGACTTACAATCCTGTAAGTATCGCGCCCCTTCTCGTCCGGTTT
TTCCAAGAGGATAGAAACATATTGACCGTGTGCAACGTAGACTCAGGATGGCCCCGATGACCCGCGCGTCCTTGT
CGAATCAGAGGATCAGCCTGAACGCCTCCTTCTCGAAACCAGGATCCAGAAGGAGGATGGCTTCCAGAAGCAACA
AGGCAAGCTGCATCTCTCGCTCCCTCTCGCGGCGCTTCGCTGACGAGAGGCCCGTGCAGAGACGTTGATTGTATG
GCAAGAACCGGGCAGCGGCGTCGACATGGCCCTGAGCTTCCAGGAAGCCGAGGGATGTGGGATGATATGGTGCGT
CTCGCCGTCTACCTCCCCAGGTATTTGCTGACTTGGTTCGCAGGCGGTTCGTCAACAGAATCCAGCAGTCCTTGC
TTCACAACACTCCCATCGTCGGTGCGTCGACCCCGCCCGCTGCCTCTCCCCCCTCTTCTCCGCCACCGCTGAGAA
CAGCAGATGATGGCCTCGACGATGAGCTTGCCGTCGAGGCGGCTCCCACCGTCGTCAGCCTCCCGCCCGCCGATC
TGGGCAACCTGGCCGATATCGAAATGACCATGCGCAACATGACGGCATCGACTGACGGCCGCGACTCTCTGGCCA
AGGCCGTCATGGAGGAAGGATACATCGGAAAGCTCATACCCTTGGTCGAGATCGCCGAGGACCTCGAGAGCCTCC
CCGACCTGCACCGGCTGTGCAACATCATGAAGACGATTCTGCTCCTCAACGACACCAGCATCATCGAACGTGCCG
TCTCGGACGAGTGCGTGCTGGGCGTCGTCGGCGCGCTCGAGTACGATCCAGACTTTCCCAGCCACAAGGCGAACC
ACCGGCTTTGGCTGGACAACGAGGGGCGCTTCAAGGAGGTGGTTCCCATCAAGGACAACAAGACGCGCGAAAAGA
TACACCAGACGTATCGCCTGCAGTACCTCAAGGATGTTGTTCTCGCCCGCATTCTCGATGATCCCACCTTTTCCG
TCCTCAACTCGCTCATCTTCTTCAACCAGGTCGACATTGTTCAGCACCTGCAGTCCAACACGGCTTTTCTCAGCG
ACCTCTTTGGCATCTTCAACTCGCGCCGCCGCGATCAGGAGAAGCGCAAGGAGGCCGTCCTCTTTATCCAGCAGT
GCTGCGCCATCGCCAAGAACATTCAACCGCCCGCGCGCCAGATGCTCTACAACAACTTCATCGCCCACGGCCTGC
TCTCCGTCATCCACTTTGGCTTGCGGCATACCGACGTCGCTGTTCGCGTCGGGGCCACCGACATCTTGATATCCA
TCATCGATCACGACCCGCAGATGATCCGGCAGACGATTTACCGGCAGATGCACGACAACCAGCCGGGCCTGACGG
ACTCGCTCATCGACCTCTTGCTGGTCGAGGTGGACCTGGGCGTCAAGTCGCAGATCGGGGAGGCGCTCAAGGTGC
TGCTGGACCAGGGCATGGTGCCCCAGGGGCCCGAACAGCTAGTAAAGACCAATGGCGAGATGCCAGGCCGGCCGA
GACCGCAGTCGTCGCTGGATCCTCAGCAGGAGCTGTTCCTGACGCGTTTCTACGAACGATCCGCCCCGAAACTGT
TCCAACCGCTGCTCGACCTCGAGAGCCGGACCGACATGAATCTGTCGGTGCACCAGGCGTCCATGTATACGTGTC
TTGTGGAGATTCTCGACTTCTTCATCCGCCAGCATCATCGCTTCAGCCGTTACCTTGTCCTGAACAACAACCTCG
CCCAGTGCGTCTGTCAGCTTCTCAAGAGCCCAGAGAAGTATATACAGCTAGGTGAGAAGCCCTTTGTTCTCTGTT
GTGGTCGCAGACTGACGCATCTTGCAGCCGCCATCCGCTTCTTCCGCCACCTGATCGGTAACCAGGAAGAGTTCT
ACATGAAGCATCTGACGGAGAAGAACGTGCTCGGACCCATTCTCAACGTCGTCGTCGAGACGCTACCGCGAGACA
ACCTGCTGAGCTCGGCGTCGCTTGAGCTATTCGACTATATTCGTAAGGAGTCTATTGTCGAAATGATCAAGCACC
TCGTCGTCAACTTCCGGGAGCGGCTGGTCAGCCTCAGCTACCTGCCAACGTTCCGGGACATGGTCCAGCGGTACG
ACCACACGCAGGGCTTCACCGTCAACATCGAGTACGTGCTCGAGGGCGAAAACGACTTTGCTCGGCGGCCACCGC
CCAACGCGCGGTTGATGGAGCAAATCGTGGTCGATCCCGTCGAGGAGGAGTACTGGAACACGTCGGACCCGGACG
ACGAAGACGACGACGAAGACGGACGCGAGACCACAGCCATCAAGACGCCATCGACCAACGGAGCCGGCACGCCGT
CGAAGCCGCTGGTGGACTATCAATCAGACGACGACAGCGACGACAGCGTCAACACCGAGGCAGCCAGAGACGACG
ACGACGTCGGCCCCAGTCCCGAGAGCGGCACCTCGCCCGTCAGCACGGAGGTGGCGCCACCACTAGAGCGGATAT
CAGAGAAGCGACGACGAGAGGAGGACGAGGAAGACGAGCTGGGAAAGCTGCTCCAGAGCAAGCGCCGCAGCAAGA
CGGCCACCGACGGCACCGCAAACGCCATGCGCAAGGCACAGCGACGGAAGAGCTTCACGCCCCACGCAGGAACCG
GCCCGCCAAGGAAAATCGCAATCAGCCTCTCCCCATCCGCGAAAGCAGGCCTCGACGAGAAGCAACAAGAGCAAT
CCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail