Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|653
Gene name
LocationContig_120:27361..30527
Strand+
Gene length (bp)3166
Transcript length (bp)3102
Coding sequence length (bp)3102
Protein length (aa) 1034

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04048 Sec8_exocyst Sec8 exocyst complex component specific domain 1.5E-46 61 198
PF10475 Vps54_N Vacuolar-sorting protein 54, of GARP complex 8.7E-10 99 240

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE88|SEC8_NEUCR Probable exocyst complex component sec8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec8 PE=3 SV=1 1 1027 0.0E+00
sp|P32855|SEC8_YEAST Exocyst complex component SEC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC8 PE=1 SV=1 36 1008 6.0E-50
sp|Q62824|EXOC4_RAT Exocyst complex component 4 OS=Rattus norvegicus GN=Exoc4 PE=1 SV=1 113 991 2.0E-45
sp|O35382|EXOC4_MOUSE Exocyst complex component 4 OS=Mus musculus GN=Exoc4 PE=1 SV=2 113 991 2.0E-42
sp|Q96A65|EXOC4_HUMAN Exocyst complex component 4 OS=Homo sapiens GN=EXOC4 PE=1 SV=1 113 991 2.0E-41
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9HE88|SEC8_NEUCR Probable exocyst complex component sec8 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec8 PE=3 SV=1 1 1027 0.0E+00
sp|P32855|SEC8_YEAST Exocyst complex component SEC8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SEC8 PE=1 SV=1 36 1008 6.0E-50
sp|Q62824|EXOC4_RAT Exocyst complex component 4 OS=Rattus norvegicus GN=Exoc4 PE=1 SV=1 113 991 2.0E-45
sp|O35382|EXOC4_MOUSE Exocyst complex component 4 OS=Mus musculus GN=Exoc4 PE=1 SV=2 113 991 2.0E-42
sp|Q96A65|EXOC4_HUMAN Exocyst complex component 4 OS=Homo sapiens GN=EXOC4 PE=1 SV=1 113 991 2.0E-41
sp|O74562|SEC8_SCHPO Exocyst complex component sec8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sec8 PE=1 SV=2 19 1007 3.0E-41
sp|Q9VNH6|EXOC4_DROME Exocyst complex component 4 OS=Drosophila melanogaster GN=Sec8 PE=1 SV=3 113 454 3.0E-15
sp|Q9VNH6|EXOC4_DROME Exocyst complex component 4 OS=Drosophila melanogaster GN=Sec8 PE=1 SV=3 733 986 3.0E-14
sp|Q93YU5|SEC8_ARATH Exocyst complex component SEC8 OS=Arabidopsis thaliana GN=SEC8 PE=1 SV=1 118 262 2.0E-13
sp|Q54P76|EXOC4_DICDI Exocyst complex component 4 OS=Dictyostelium discoideum GN=exoc4 PE=3 SV=1 115 260 2.0E-10
sp|Q54P76|EXOC4_DICDI Exocyst complex component 4 OS=Dictyostelium discoideum GN=exoc4 PE=3 SV=1 635 954 3.0E-08
sp|Q9XWS2|EXOC4_CAEEL Exocyst complex component 4 OS=Caenorhabditis elegans GN=sec-8 PE=2 SV=2 744 1000 4.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006904 vesicle docking involved in exocytosis Yes
GO:0000145 exocyst Yes
GO:0051179 localization No
GO:0032991 protein-containing complex No
GO:0099023 vesicle tethering complex No
GO:0048278 vesicle docking No
GO:0140056 organelle localization by membrane tethering No
GO:0140029 exocytic process No
GO:0009987 cellular process No
GO:0005575 cellular_component No
GO:0051640 organelle localization No
GO:0008150 biological_process No
GO:0022406 membrane docking No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|653
MSNRYRNGGDYDPYAYDDGHSDDRYGSRPAVSPRAPPPPTHRTKPSRSRMRETSAERQMGVVMDHIRSEWPSMCE
ADCVPVQLALQLLDPSSVGRAHDYRKFRKTHAYLQDSLKNIVHEHHQGFNSSIGTFHSIQGSIQASQKRVRELKD
SLASAKTSLCSTDPTLKTLSQTSQDYDDLLQMLNELEDLRAVPDQLEARISEKRFLTAVDVLHKALRKLRRPELD
AIGALSDLKSYLANQESVLMDILVEELHEHLYLKSPYCQERWQSLAKSKGAYTDGYGDANSIAAFLTVLESIDAD
KAASEDPNRNPEADTFSYIGLLVEALNKLDRLQNAVEMLKQRLPVELFSIVTETIKDVDQRHPSSLRGAASKTKG
LLLYGTRETQLRADVIHDLLWQLYGKFEAIGEGHRVFHESIKALIRREGAGNNSALLGSFKELWNLYQNEIRSLL
HNYVTTDADVYQFDSPLVGTGLNGKKDAMRDHLFKFAETDARSTDVTTEYDALEAIIQGTVPGLTRKTGVDSKKN
RVTIDGAASRRDTAYGLGKTTGPLKSLVEPSVFNMSLMLPPTLVFLQRLKGIVPPGSDLATSTLTTFLDNFLVNV
FQPQLDETLGKLSETVFGEADAFLQDPTWSQSAPRPVFKGTTAFFEVVTAFCRMLSTIPPDQALSALIVSQMVRY
YERCLAWYKALVTKTQEQGSKASKLRASARFAVQADELQETMKRLWTSDGMDQALLEKEVHLLMDQTNESGLEMD
DVIQDRETISSLCLLYTSMKWFAAKISSLRRITMHETDSSRQSVPRQAKQRWTLMNDPSKAASEQGPASLPLTQE
TVQTFDSMVTSFEELAGTALLTLHMEVRCRIVYSLRSVLSPNKKAHLLDQEVRQPDPQILSLNLELVLFDETIVR
FLRGREVAFVRTGLGLLTNSYLVGNASMASPMNAKGNGRMQLNILVLQQNLKNIEEGVDLARAANYFALFDQGPE
AIVEQGKNKAEGRFAYEELRTLVELYYSEQMERGVASSAKRLMEETLQTLGEAAGVGG*
Coding >Ophun1|653
ATGTCGAACCGATACCGCAACGGCGGCGACTACGACCCCTATGCTTACGATGACGGCCATTCGGACGACCGATAT
GGGTCCCGTCCGGCCGTGTCGCCTCGGGCCCCCCCGCCGCCGACCCATCGGACGAAGCCGTCCCGTTCGAGGATG
CGCGAGACGAGCGCCGAGAGACAGATGGGCGTCGTCATGGATCACATCCGGTCCGAATGGCCGTCCATGTGCGAG
GCCGACTGCGTCCCCGTCCAGCTGGCCCTGCAGCTGCTGGACCCTAGCTCCGTCGGCCGAGCGCATGATTACCGC
AAGTTTCGCAAGACGCACGCCTATCTGCAGGACTCGCTCAAGAACATCGTCCACGAGCATCATCAGGGTTTCAAC
AGCTCCATAGGCACCTTTCACAGCATCCAAGGCAGCATTCAGGCGTCTCAGAAGCGCGTTCGCGAACTCAAAGAC
TCGCTGGCAAGCGCAAAGACGAGCCTTTGCTCGACGGATCCGACACTCAAGACGCTGTCCCAGACGTCTCAGGAT
TACGACGATCTGCTACAAATGCTCAACGAGCTCGAAGACCTGCGCGCTGTCCCGGATCAGCTCGAGGCCCGCATC
TCCGAGAAGCGCTTTCTTACTGCCGTCGACGTGCTCCACAAAGCGCTACGCAAGCTGAGGCGGCCCGAACTGGAT
GCCATTGGCGCTCTCAGCGACCTGAAGAGCTACCTCGCCAACCAAGAGTCCGTTCTGATGGACATCTTGGTCGAG
GAGCTTCACGAACATCTGTATCTCAAGTCGCCTTACTGTCAAGAGAGGTGGCAGAGCCTGGCCAAGAGCAAGGGC
GCCTACACCGATGGCTACGGAGACGCCAACTCCATTGCGGCTTTTCTCACAGTTCTGGAATCCATCGACGCTGAC
AAGGCCGCTTCCGAAGACCCGAACAGAAATCCAGAGGCGGATACCTTCTCCTACATTGGCCTGCTCGTCGAGGCT
CTTAACAAGCTCGACAGGTTACAGAACGCCGTGGAGATGCTGAAGCAGCGGCTCCCCGTCGAGCTTTTCAGCATC
GTTACCGAGACCATCAAGGACGTTGACCAGCGTCACCCGAGCTCGCTTCGAGGCGCTGCCAGCAAGACCAAGGGC
CTCTTGCTCTACGGGACCAGGGAGACTCAGCTGAGGGCCGACGTCATCCACGATCTCCTGTGGCAGCTGTACGGC
AAGTTTGAGGCCATCGGTGAGGGCCATCGCGTCTTTCACGAGTCCATCAAGGCTCTTATCCGTCGAGAGGGCGCT
GGAAACAACAGCGCGCTCCTGGGCAGCTTCAAGGAGCTGTGGAACCTGTATCAGAACGAGATTAGATCGCTCCTA
CACAACTACGTCACTACCGACGCCGACGTCTATCAGTTCGACTCGCCCCTCGTCGGCACCGGCCTCAATGGCAAG
AAGGACGCCATGCGCGATCACCTATTCAAGTTTGCCGAGACTGATGCCAGGTCGACCGACGTGACGACTGAGTAC
GACGCTCTGGAGGCCATCATCCAGGGCACGGTGCCGGGCCTGACGAGGAAGACGGGCGTCGACTCGAAGAAGAAC
CGGGTCACTATAGACGGCGCCGCGTCGAGGCGCGACACCGCTTACGGACTTGGCAAGACCACGGGCCCGCTCAAG
TCGCTCGTGGAGCCAAGCGTATTCAACATGAGCCTTATGCTGCCGCCGACGCTGGTGTTCCTGCAGAGACTCAAG
GGCATCGTACCTCCGGGCTCGGATCTCGCTACCAGCACGCTGACGACGTTCCTGGATAACTTCCTGGTCAACGTC
TTCCAACCGCAGCTGGATGAGACGCTCGGCAAACTGAGTGAGACCGTCTTCGGCGAGGCGGACGCCTTTCTGCAG
GACCCAACTTGGAGCCAATCGGCACCACGGCCGGTGTTCAAGGGCACAACAGCTTTTTTCGAGGTGGTGACGGCC
TTTTGCCGCATGCTCAGCACGATACCGCCAGACCAGGCGTTGAGCGCACTCATCGTGAGCCAGATGGTGCGATAT
TACGAACGATGCCTCGCGTGGTACAAGGCGCTCGTCACCAAGACGCAGGAGCAGGGTTCAAAGGCCAGCAAGCTC
AGGGCCTCGGCCCGCTTCGCCGTGCAGGCGGACGAACTGCAGGAGACGATGAAGAGGCTGTGGACGTCGGACGGC
ATGGACCAGGCTCTATTGGAAAAAGAGGTTCATTTGCTGATGGACCAGACGAACGAGTCGGGGCTGGAGATGGAC
GACGTGATTCAAGACCGGGAAACTATCTCATCGCTCTGTCTGCTGTACACGAGTATGAAGTGGTTTGCGGCCAAG
ATCTCGAGCCTGAGGCGCATCACCATGCACGAGACGGATTCATCACGGCAGTCGGTGCCACGGCAGGCGAAACAG
CGGTGGACACTGATGAACGACCCAAGCAAGGCGGCGTCGGAGCAGGGCCCAGCGAGTCTGCCGCTGACGCAGGAG
ACGGTCCAGACGTTTGACAGTATGGTGACGTCGTTTGAGGAGCTTGCGGGCACGGCGCTGCTGACGCTGCACATG
GAGGTGCGGTGCCGGATCGTGTATTCGCTGCGGAGCGTCTTGTCGCCCAACAAGAAGGCGCATCTCCTGGATCAG
GAGGTCAGGCAGCCGGACCCGCAGATATTGAGTCTGAATCTGGAGCTGGTGCTCTTTGACGAGACCATTGTACGC
TTCCTCCGCGGTCGGGAAGTGGCTTTTGTCCGGACCGGACTCGGGCTGCTCACCAACAGCTACCTGGTGGGAAAC
GCTTCGATGGCATCGCCCATGAATGCCAAGGGGAACGGGCGGATGCAGCTCAACATCTTGGTGCTGCAGCAGAAC
CTCAAGAATATCGAGGAGGGCGTGGATCTGGCACGGGCAGCCAACTACTTTGCCCTCTTCGACCAGGGACCCGAG
GCCATAGTGGAACAGGGCAAGAACAAGGCCGAGGGACGATTTGCCTACGAGGAGCTCAGAACACTGGTCGAGCTG
TACTACAGCGAGCAGATGGAGAGGGGGGTTGCGTCATCGGCGAAGCGGCTGATGGAGGAGACGCTGCAGACGCTT
GGCGAGGCGGCGGGAGTAGGCGGATGA
Transcript >Ophun1|653
ATGTCGAACCGATACCGCAACGGCGGCGACTACGACCCCTATGCTTACGATGACGGCCATTCGGACGACCGATAT
GGGTCCCGTCCGGCCGTGTCGCCTCGGGCCCCCCCGCCGCCGACCCATCGGACGAAGCCGTCCCGTTCGAGGATG
CGCGAGACGAGCGCCGAGAGACAGATGGGCGTCGTCATGGATCACATCCGGTCCGAATGGCCGTCCATGTGCGAG
GCCGACTGCGTCCCCGTCCAGCTGGCCCTGCAGCTGCTGGACCCTAGCTCCGTCGGCCGAGCGCATGATTACCGC
AAGTTTCGCAAGACGCACGCCTATCTGCAGGACTCGCTCAAGAACATCGTCCACGAGCATCATCAGGGTTTCAAC
AGCTCCATAGGCACCTTTCACAGCATCCAAGGCAGCATTCAGGCGTCTCAGAAGCGCGTTCGCGAACTCAAAGAC
TCGCTGGCAAGCGCAAAGACGAGCCTTTGCTCGACGGATCCGACACTCAAGACGCTGTCCCAGACGTCTCAGGAT
TACGACGATCTGCTACAAATGCTCAACGAGCTCGAAGACCTGCGCGCTGTCCCGGATCAGCTCGAGGCCCGCATC
TCCGAGAAGCGCTTTCTTACTGCCGTCGACGTGCTCCACAAAGCGCTACGCAAGCTGAGGCGGCCCGAACTGGAT
GCCATTGGCGCTCTCAGCGACCTGAAGAGCTACCTCGCCAACCAAGAGTCCGTTCTGATGGACATCTTGGTCGAG
GAGCTTCACGAACATCTGTATCTCAAGTCGCCTTACTGTCAAGAGAGGTGGCAGAGCCTGGCCAAGAGCAAGGGC
GCCTACACCGATGGCTACGGAGACGCCAACTCCATTGCGGCTTTTCTCACAGTTCTGGAATCCATCGACGCTGAC
AAGGCCGCTTCCGAAGACCCGAACAGAAATCCAGAGGCGGATACCTTCTCCTACATTGGCCTGCTCGTCGAGGCT
CTTAACAAGCTCGACAGGTTACAGAACGCCGTGGAGATGCTGAAGCAGCGGCTCCCCGTCGAGCTTTTCAGCATC
GTTACCGAGACCATCAAGGACGTTGACCAGCGTCACCCGAGCTCGCTTCGAGGCGCTGCCAGCAAGACCAAGGGC
CTCTTGCTCTACGGGACCAGGGAGACTCAGCTGAGGGCCGACGTCATCCACGATCTCCTGTGGCAGCTGTACGGC
AAGTTTGAGGCCATCGGTGAGGGCCATCGCGTCTTTCACGAGTCCATCAAGGCTCTTATCCGTCGAGAGGGCGCT
GGAAACAACAGCGCGCTCCTGGGCAGCTTCAAGGAGCTGTGGAACCTGTATCAGAACGAGATTAGATCGCTCCTA
CACAACTACGTCACTACCGACGCCGACGTCTATCAGTTCGACTCGCCCCTCGTCGGCACCGGCCTCAATGGCAAG
AAGGACGCCATGCGCGATCACCTATTCAAGTTTGCCGAGACTGATGCCAGGTCGACCGACGTGACGACTGAGTAC
GACGCTCTGGAGGCCATCATCCAGGGCACGGTGCCGGGCCTGACGAGGAAGACGGGCGTCGACTCGAAGAAGAAC
CGGGTCACTATAGACGGCGCCGCGTCGAGGCGCGACACCGCTTACGGACTTGGCAAGACCACGGGCCCGCTCAAG
TCGCTCGTGGAGCCAAGCGTATTCAACATGAGCCTTATGCTGCCGCCGACGCTGGTGTTCCTGCAGAGACTCAAG
GGCATCGTACCTCCGGGCTCGGATCTCGCTACCAGCACGCTGACGACGTTCCTGGATAACTTCCTGGTCAACGTC
TTCCAACCGCAGCTGGATGAGACGCTCGGCAAACTGAGTGAGACCGTCTTCGGCGAGGCGGACGCCTTTCTGCAG
GACCCAACTTGGAGCCAATCGGCACCACGGCCGGTGTTCAAGGGCACAACAGCTTTTTTCGAGGTGGTGACGGCC
TTTTGCCGCATGCTCAGCACGATACCGCCAGACCAGGCGTTGAGCGCACTCATCGTGAGCCAGATGGTGCGATAT
TACGAACGATGCCTCGCGTGGTACAAGGCGCTCGTCACCAAGACGCAGGAGCAGGGTTCAAAGGCCAGCAAGCTC
AGGGCCTCGGCCCGCTTCGCCGTGCAGGCGGACGAACTGCAGGAGACGATGAAGAGGCTGTGGACGTCGGACGGC
ATGGACCAGGCTCTATTGGAAAAAGAGGTTCATTTGCTGATGGACCAGACGAACGAGTCGGGGCTGGAGATGGAC
GACGTGATTCAAGACCGGGAAACTATCTCATCGCTCTGTCTGCTGTACACGAGTATGAAGTGGTTTGCGGCCAAG
ATCTCGAGCCTGAGGCGCATCACCATGCACGAGACGGATTCATCACGGCAGTCGGTGCCACGGCAGGCGAAACAG
CGGTGGACACTGATGAACGACCCAAGCAAGGCGGCGTCGGAGCAGGGCCCAGCGAGTCTGCCGCTGACGCAGGAG
ACGGTCCAGACGTTTGACAGTATGGTGACGTCGTTTGAGGAGCTTGCGGGCACGGCGCTGCTGACGCTGCACATG
GAGGTGCGGTGCCGGATCGTGTATTCGCTGCGGAGCGTCTTGTCGCCCAACAAGAAGGCGCATCTCCTGGATCAG
GAGGTCAGGCAGCCGGACCCGCAGATATTGAGTCTGAATCTGGAGCTGGTGCTCTTTGACGAGACCATTGTACGC
TTCCTCCGCGGTCGGGAAGTGGCTTTTGTCCGGACCGGACTCGGGCTGCTCACCAACAGCTACCTGGTGGGAAAC
GCTTCGATGGCATCGCCCATGAATGCCAAGGGGAACGGGCGGATGCAGCTCAACATCTTGGTGCTGCAGCAGAAC
CTCAAGAATATCGAGGAGGGCGTGGATCTGGCACGGGCAGCCAACTACTTTGCCCTCTTCGACCAGGGACCCGAG
GCCATAGTGGAACAGGGCAAGAACAAGGCCGAGGGACGATTTGCCTACGAGGAGCTCAGAACACTGGTCGAGCTG
TACTACAGCGAGCAGATGGAGAGGGGGGTTGCGTCATCGGCGAAGCGGCTGATGGAGGAGACGCTGCAGACGCTT
GGCGAGGCGGCGGGAGTAGGCGGATGA
Gene >Ophun1|653
ATGTCGAACCGATACCGCAACGGCGGCGACTACGACCCCTATGCTTACGATGACGGCCATTCGGACGACCGATAT
GGGTCCCGTCCGGCCGTGTCGCCTCGGGCCCCCCCGCCGCCGACCCATCGGACGAAGCCGTCCCGTTCGAGGATG
CGCGAGACGAGCGCCGAGAGACAGATGGGCGTCGTCATGGATCACATCCGGTCCGAATGGCCGTCCATGTGCGAG
GCCGACTGCGTCCCCGTCCAGCTGGCCCTGCAGCTGCTGGACCCTAGCTCCGTCGGCCGAGCGCATGATTACCGC
AAGTTTCGCAAGACGCACGCCTATCTGCAGGACTCGCTCAAGAACATCGTCCACGAGCATCATCAGGGTTTCAAC
AGCTCCATAGGCACCTTTCACAGCATCCAAGGCAGCATTCAGGCGTCTCAGAAGCGCGTTCGCGAACTCAAAGAC
TCGCTGGCAAGCGCAAAGACGAGCCTTTGCTCGACGGATCCGACACTCAAGACGCTGTCCCAGACGTCTCAGGAT
TACGACGATCTGCTACAAATGCTCAACGAGCTCGAAGACCTGCGCGCTGTCCCGGATCAGCTCGAGGCCCGCATC
TCCGAGAAGCGCTTTCTTACTGCCGTCGACGTGCTCCACAAAGCGCTACGCAAGCTGAGGCGGCCCGAACTGGAT
GCCATTGGCGCTCTCAGCGACCTGAAGAGCTACCTCGCCAACCAAGAGTCCGTTCTGATGGACATCTTGGTCGAG
GAGCTTCACGAACATCTGTATCTCAAGTCGCCTTACTGTCAAGAGAGGTGGCAGAGCCTGGCCAAGAGCAAGGGC
GCCTACACCGATGGCTACGGAGACGCCAACTCCATTGCGGCTTTTCTCACAGTTCTGGAATCCATCGACGCTGAC
AAGGCCGCTTCCGAAGACCCGAACAGAAATCCAGAGGCGGATACCTTCTCCTACATTGGCCTGCTCGTCGAGGCT
CTTAACAAGCTCGACAGGTTACAGAACGCCGTGGAGATGCTGAAGCAGCGGCTCCCCGTCGAGCTTTTCAGCATC
GTTACCGAGACCATCAAGGACGTTGACCAGCGTCACCCGAGCTCGCTTCGAGGCGCTGCCAGCAAGACCAAGGGC
CTCTTGCTCTACGGGACCAGGGAGACTCAGCTGAGGGCCGACGTCATCCACGATCTCCTGTGGCAGCTGTACGGC
AAGTTTGAGGCCATCGGTGAGGGCCATCGCGTCTTTCACGAGTCCATCAAGGCTCTTATCCGTCGAGAGGGCGCT
GGAAACAACAGCGCGCTCCTGGGCAGCTTCAAGGAGCTGTGGAACCTGTATCAGAACGAGATTAGATCGCTCCTA
CACAACTACGTCACTACCGACGCCGACGTCTATCAGTTCGACTCGCCCCTCGTCGGCACCGGCCTCAATGGCAAG
AAGGACGCCATGCGCGATCACCTATTCAAGTTTGCCGAGACTGATGCCAGGTCGACCGACGTGACGACTGAGTAC
GACGCTCTGGAGGCCATCATCCAGGGCACGGTGCCGGGCCTGACGAGGAAGACGGGCGTCGACTCGAAGAAGAAC
CGGGTCACTATAGACGGCGCCGCGTCGAGGCGCGACACCGCTTACGGACTTGGCAAGACCACGGGCCCGCTCAAG
TCGCTCGTGGAGCCAAGCGTATTCAACATGAGCCTTATGCTGCCGCCGACGCTGGTGTTCCTGCAGAGACTCAAG
GGCATCGTACCTCCGGGCTCGGATCTCGCTACCAGCACGCTGACGACGTTCCTGGATAACTTCCTGGTCAACGTC
TTCCAACCGCAGCTGGATGAGACGCTCGGCAAACTGAGTGAGACCGTCTTCGGCGAGGCGGACGCCTTTCTGCAG
GACCCAACTTGGAGCCAATCGGCACCACGGCCGGTGTTCAAGGGCACAACAGCTTTTTTCGAGGTGGTGACGGCC
TTTTGCCGCATGCTCAGCACGATACCGCCAGACCAGGCGTTGAGCGCACTCATCGTGAGCCAGATGGTGCGATAT
TACGAACGATGCCTCGCGTGGTACAAGGCGCTCGTCACCAAGACGCAGGAGCAGGGTTCAAAGGCCAGCAAGCTC
AGGGCCTCGGCCCGCTTCGCCGTGCAGGCGGACGAACTGCAGGAGACGATGAAGAGGCTGTGGACGTCGGACGGC
ATGGACCAGGCTCTATTGGAAAAAGAGGTTCATTTGCTGATGGACCAGACGAACGAGTCGGGGCTGGAGATGGAC
GACGTGATTCAAGACCGGGAAACTATCTCATCGCTCTGTCTGCTGTACACGAGTATGAAGTGGTTTGCGGCCAAG
ATCTCGAGCCTGAGGCGCATCACCATGCACGAGACGGATTCATCACGGCAGTCGGTGCCACGGCAGGCGAAACAG
CGGTGGACACTGATGAACGACCCAAGCAAGGCGGCGTCGGAGCAGGGCCCAGCGAGTCTGCCGCTGACGCAGGAG
ACGGTCCAGTAAGTGCATCCGGACGAGTGGACAAGTTGTCAGGGAGCGGGCTGACAGAGCTTTTCGATAAAGGAC
GTTTGACAGTATGGTGACGTCGTTTGAGGAGCTTGCGGGCACGGCGCTGCTGACGCTGCACATGGAGGTGCGGTG
CCGGATCGTGTATTCGCTGCGGAGCGTCTTGTCGCCCAACAAGAAGGCGCATCTCCTGGATCAGGAGGTCAGGCA
GCCGGACCCGCAGATATTGAGTCTGAATCTGGAGCTGGTGCTCTTTGACGAGACCATTGTACGCTTCCTCCGCGG
TCGGGAAGTGGCTTTTGTCCGGACCGGACTCGGGCTGCTCACCAACAGCTACCTGGTGGGAAACGCTTCGATGGC
ATCGCCCATGAATGCCAAGGGGAACGGGCGGATGCAGCTCAACATCTTGGTGCTGCAGCAGAACCTCAAGAATAT
CGAGGAGGGCGTGGATCTGGCACGGGCAGCCAACTACTTTGCCCTCTTCGACCAGGGACCCGAGGCCATAGTGGA
ACAGGGCAAGAACAAGGCCGAGGGACGATTTGCCTACGAGGAGCTCAGAACACTGGTCGAGCTGTACTACAGCGA
GCAGATGGAGAGGGGGGTTGCGTCATCGGCGAAGCGGCTGATGGAGGAGACGCTGCAGACGCTTGGCGAGGCGGC
GGGAGTAGGCGGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail