Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|652
Gene name
LocationContig_120:24142..26866
Strand+
Gene length (bp)2724
Transcript length (bp)2613
Coding sequence length (bp)2613
Protein length (aa) 871

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12722 Hid1 High-temperature-induced dauer-formation protein 8.3E-295 1 820
PF09742 Dymeclin Dyggve-Melchior-Clausen syndrome protein 8.9E-82 1 772

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13776|FT105_SCHPO Ubp5-interacting protein ftp105 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ftp105 PE=1 SV=2 1 792 8.0E-119
sp|Q8IV36|HID1_HUMAN Protein HID1 OS=Homo sapiens GN=HID1 PE=1 SV=1 1 821 2.0E-93
sp|Q8R1F6|HID1_MOUSE Protein HID1 OS=Mus musculus GN=Hid1 PE=1 SV=1 1 821 5.0E-90
sp|Q9P7M6|YIOC_SCHPO Hid-1 family protein P27G11.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP27G11.12 PE=3 SV=1 1 818 3.0E-84
sp|Q54JJ6|HID1_DICDI Protein HID1 OS=Dictyostelium discoideum GN=hid1 PE=3 SV=1 159 822 2.0E-46
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13776|FT105_SCHPO Ubp5-interacting protein ftp105 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ftp105 PE=1 SV=2 1 792 8.0E-119
sp|Q8IV36|HID1_HUMAN Protein HID1 OS=Homo sapiens GN=HID1 PE=1 SV=1 1 821 2.0E-93
sp|Q8R1F6|HID1_MOUSE Protein HID1 OS=Mus musculus GN=Hid1 PE=1 SV=1 1 821 5.0E-90
sp|Q9P7M6|YIOC_SCHPO Hid-1 family protein P27G11.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAP27G11.12 PE=3 SV=1 1 818 3.0E-84
sp|Q54JJ6|HID1_DICDI Protein HID1 OS=Dictyostelium discoideum GN=hid1 PE=3 SV=1 159 822 2.0E-46
sp|Q9HDV3|YOE7_SCHPO Hid-1 family protein P19A11.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1346.03 PE=3 SV=3 1 565 1.0E-12
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|652
MGASDSKIVFKQGIFRLSEERHIPADDTYWTSFWELPESAEDVFSLFSPADIRRTRDQALENIETLVLALTSRLF
ILRHHPSFPDPELAPERDALNCVRILTRILPYIYEKESLKPWEERFFWGTRRKKSRRAAIANEVLFDEAQDGKQD
APAENDEFLDVKPLAEELIDTLIDLLFFSDLTIPRQPHGQSKVTYAIWQSGVGCNSAVATTKEFENNRCEILRLL
LALAGQSMYFTPGVLPQRGVRTLTYLCTCQEKQVVLSVLCSLLNTTLKYNPASWRVPYNTLVFRDPKQILVTYSL
QLMLVLLVYPIPEQASAQKNFYRHFLGRLHRPQDFQFIVDGISRILSQPLQDKTSYLPGPQTSGNLTPEMLMLFW
ELTQCNKRFRSFIIDTERAHDFVVLTLFHALEYKSDPAKQGVVRMCAFLLQTLSVETNFGHNLNKRFEGQESLPA
CIRINGFNGSYTDFLVHSIYSLITSSQGNFAAVYPALLAVINNIAPHIEGLGAAGSSQLMLLFSSMSSPSFLLAN
ETNHTLLDSLLESINSIIETKYRENPEMMLAIVKSRKRIEALRSFTLESGQEELERRSRRRKDGVGQGDGADTGS
VRSSVDSARSPPPVPSRLPTLGQVPEDSAFAIGDNEEDDSDDDPQPTPAPSTTSENQSQASSAVNMEDAVPTQLR
GMSEKARGKMPAATRSFSRQNSTTSLGSQPVSGRTQGGGFEPTAQWIDSWLPELPLHSILTLIQQVTSLVPAREA
VSMDTIRQVQEMGLVGVEPSPPHVHSFEWSQPALAWYESLLWGMIFTSEMQIAKGTMGMWNGTSIKLFRVQETAP
EGPTLTSPRGAVDAVGSNIVSRIGQINLRGGPTQAGGNPPSRAGV*
Coding >Ophun1|652
ATGGGCGCCAGCGACTCCAAGATTGTCTTCAAGCAGGGAATCTTCAGGCTATCCGAGGAGCGTCACATCCCCGCG
GACGACACTTACTGGACCTCGTTTTGGGAGCTCCCAGAGTCGGCGGAAGATGTCTTTAGCCTATTCTCTCCTGCA
GACATCCGACGCACCCGAGACCAGGCTCTGGAAAACATCGAAACACTTGTGCTTGCGCTGACGTCGCGCCTCTTC
ATCCTCCGCCACCACCCCTCATTTCCCGACCCCGAACTGGCGCCCGAGCGAGACGCGCTGAACTGCGTCAGAATC
CTGACACGGATTCTGCCTTACATCTACGAGAAAGAGAGCCTCAAGCCTTGGGAGGAACGGTTCTTCTGGGGAACG
CGGCGCAAGAAAAGCCGCCGCGCCGCCATCGCCAACGAGGTGCTGTTCGACGAGGCTCAGGACGGCAAGCAGGAT
GCGCCGGCCGAGAATGACGAGTTCCTCGACGTCAAGCCCTTGGCCGAGGAGCTTATAGATACGCTGATAGACCTG
CTTTTCTTTTCGGACCTGACCATTCCCCGTCAGCCCCATGGCCAGTCCAAGGTCACCTATGCCATCTGGCAAAGT
GGCGTCGGCTGCAACTCGGCCGTGGCAACGACGAAGGAGTTTGAAAACAACAGGTGTGAGATACTGCGGCTGCTC
TTGGCCCTCGCCGGCCAGAGCATGTACTTCACACCAGGAGTCCTTCCGCAGAGGGGGGTTCGGACATTGACCTAT
CTCTGCACATGTCAGGAGAAGCAGGTCGTGCTCTCCGTCCTGTGTTCGCTGCTGAACACGACGCTCAAGTATAAC
CCTGCTAGCTGGCGAGTCCCGTACAACACGCTGGTGTTTAGGGACCCGAAGCAGATACTTGTCACGTATTCCTTG
CAACTCATGCTCGTTCTACTCGTCTATCCGATCCCAGAGCAAGCTTCCGCGCAAAAGAATTTCTATCGACATTTC
CTCGGCCGACTTCATCGCCCCCAGGATTTCCAGTTCATCGTGGATGGCATCAGCCGCATCCTTAGCCAACCGTTG
CAGGACAAGACGTCTTATCTGCCAGGACCTCAGACCTCGGGAAACTTGACCCCGGAAATGCTGATGCTCTTTTGG
GAGCTCACTCAGTGCAACAAGCGGTTCCGGTCCTTCATCATCGATACCGAGCGAGCCCACGATTTCGTCGTCTTG
ACGTTGTTTCATGCCTTGGAGTATAAGAGCGATCCGGCTAAACAGGGAGTGGTTCGCATGTGTGCGTTCTTATTG
CAAACGCTGAGCGTCGAGACCAACTTCGGTCACAATCTCAACAAGCGTTTCGAAGGCCAGGAGAGCCTGCCCGCA
TGCATCAGGATCAACGGTTTCAACGGCTCTTATACCGACTTTCTCGTGCACTCCATCTACAGCCTGATAACCTCG
AGCCAAGGCAACTTCGCCGCCGTGTATCCTGCTCTCTTGGCCGTTATCAACAATATTGCACCGCACATCGAGGGA
CTGGGAGCCGCGGGCAGCTCTCAGCTCATGCTCTTGTTTTCTTCCATGTCTTCGCCGTCGTTCCTTCTCGCGAAC
GAAACCAACCACACACTCCTCGACTCGCTCCTCGAGTCCATCAATAGCATCATCGAAACCAAGTATCGCGAGAAC
CCGGAGATGATGCTGGCAATCGTCAAGAGCCGGAAGCGGATCGAGGCTCTGCGGTCCTTTACTCTTGAGAGCGGC
CAGGAAGAGCTGGAAAGAAGAAGTCGGAGAAGAAAAGACGGCGTCGGTCAGGGAGACGGTGCCGACACCGGGTCA
GTCAGGAGCTCGGTCGACAGCGCAAGGAGCCCACCGCCTGTACCGTCTCGACTGCCGACGCTGGGGCAGGTGCCC
GAAGACAGCGCGTTCGCAATCGGCGATAACGAAGAGGACGATAGTGACGACGACCCGCAGCCGACGCCAGCGCCC
TCCACCACCAGCGAGAACCAGTCTCAGGCATCTTCGGCCGTGAACATGGAAGACGCGGTACCGACGCAGCTGCGC
GGCATGTCGGAGAAGGCTCGCGGCAAGATGCCGGCAGCGACCCGATCCTTCTCACGGCAAAATAGCACCACGAGT
CTGGGATCGCAGCCCGTCTCGGGGCGGACTCAGGGAGGGGGGTTCGAACCTACAGCGCAGTGGATTGACAGCTGG
CTCCCAGAGTTGCCGCTGCATTCCATCCTTACTCTTATCCAGCAGGTAACGAGCCTGGTTCCCGCCAGGGAAGCC
GTGTCGATGGATACGATCCGGCAAGTCCAGGAGATGGGCCTCGTTGGAGTCGAGCCGTCGCCGCCGCACGTGCAC
TCGTTTGAGTGGTCTCAGCCGGCGCTGGCCTGGTACGAGTCGCTCTTGTGGGGGATGATTTTCACGAGCGAGATG
CAGATTGCCAAGGGAACCATGGGCATGTGGAACGGCACATCGATCAAGCTCTTTCGTGTCCAGGAGACTGCGCCC
GAAGGCCCTACCTTGACGTCCCCTCGGGGAGCTGTCGATGCCGTGGGGAGCAACATCGTGTCCCGGATCGGCCAG
ATCAACCTCCGGGGCGGGCCAACGCAGGCCGGCGGCAACCCTCCGTCCAGGGCTGGGGTCTAG
Transcript >Ophun1|652
ATGGGCGCCAGCGACTCCAAGATTGTCTTCAAGCAGGGAATCTTCAGGCTATCCGAGGAGCGTCACATCCCCGCG
GACGACACTTACTGGACCTCGTTTTGGGAGCTCCCAGAGTCGGCGGAAGATGTCTTTAGCCTATTCTCTCCTGCA
GACATCCGACGCACCCGAGACCAGGCTCTGGAAAACATCGAAACACTTGTGCTTGCGCTGACGTCGCGCCTCTTC
ATCCTCCGCCACCACCCCTCATTTCCCGACCCCGAACTGGCGCCCGAGCGAGACGCGCTGAACTGCGTCAGAATC
CTGACACGGATTCTGCCTTACATCTACGAGAAAGAGAGCCTCAAGCCTTGGGAGGAACGGTTCTTCTGGGGAACG
CGGCGCAAGAAAAGCCGCCGCGCCGCCATCGCCAACGAGGTGCTGTTCGACGAGGCTCAGGACGGCAAGCAGGAT
GCGCCGGCCGAGAATGACGAGTTCCTCGACGTCAAGCCCTTGGCCGAGGAGCTTATAGATACGCTGATAGACCTG
CTTTTCTTTTCGGACCTGACCATTCCCCGTCAGCCCCATGGCCAGTCCAAGGTCACCTATGCCATCTGGCAAAGT
GGCGTCGGCTGCAACTCGGCCGTGGCAACGACGAAGGAGTTTGAAAACAACAGGTGTGAGATACTGCGGCTGCTC
TTGGCCCTCGCCGGCCAGAGCATGTACTTCACACCAGGAGTCCTTCCGCAGAGGGGGGTTCGGACATTGACCTAT
CTCTGCACATGTCAGGAGAAGCAGGTCGTGCTCTCCGTCCTGTGTTCGCTGCTGAACACGACGCTCAAGTATAAC
CCTGCTAGCTGGCGAGTCCCGTACAACACGCTGGTGTTTAGGGACCCGAAGCAGATACTTGTCACGTATTCCTTG
CAACTCATGCTCGTTCTACTCGTCTATCCGATCCCAGAGCAAGCTTCCGCGCAAAAGAATTTCTATCGACATTTC
CTCGGCCGACTTCATCGCCCCCAGGATTTCCAGTTCATCGTGGATGGCATCAGCCGCATCCTTAGCCAACCGTTG
CAGGACAAGACGTCTTATCTGCCAGGACCTCAGACCTCGGGAAACTTGACCCCGGAAATGCTGATGCTCTTTTGG
GAGCTCACTCAGTGCAACAAGCGGTTCCGGTCCTTCATCATCGATACCGAGCGAGCCCACGATTTCGTCGTCTTG
ACGTTGTTTCATGCCTTGGAGTATAAGAGCGATCCGGCTAAACAGGGAGTGGTTCGCATGTGTGCGTTCTTATTG
CAAACGCTGAGCGTCGAGACCAACTTCGGTCACAATCTCAACAAGCGTTTCGAAGGCCAGGAGAGCCTGCCCGCA
TGCATCAGGATCAACGGTTTCAACGGCTCTTATACCGACTTTCTCGTGCACTCCATCTACAGCCTGATAACCTCG
AGCCAAGGCAACTTCGCCGCCGTGTATCCTGCTCTCTTGGCCGTTATCAACAATATTGCACCGCACATCGAGGGA
CTGGGAGCCGCGGGCAGCTCTCAGCTCATGCTCTTGTTTTCTTCCATGTCTTCGCCGTCGTTCCTTCTCGCGAAC
GAAACCAACCACACACTCCTCGACTCGCTCCTCGAGTCCATCAATAGCATCATCGAAACCAAGTATCGCGAGAAC
CCGGAGATGATGCTGGCAATCGTCAAGAGCCGGAAGCGGATCGAGGCTCTGCGGTCCTTTACTCTTGAGAGCGGC
CAGGAAGAGCTGGAAAGAAGAAGTCGGAGAAGAAAAGACGGCGTCGGTCAGGGAGACGGTGCCGACACCGGGTCA
GTCAGGAGCTCGGTCGACAGCGCAAGGAGCCCACCGCCTGTACCGTCTCGACTGCCGACGCTGGGGCAGGTGCCC
GAAGACAGCGCGTTCGCAATCGGCGATAACGAAGAGGACGATAGTGACGACGACCCGCAGCCGACGCCAGCGCCC
TCCACCACCAGCGAGAACCAGTCTCAGGCATCTTCGGCCGTGAACATGGAAGACGCGGTACCGACGCAGCTGCGC
GGCATGTCGGAGAAGGCTCGCGGCAAGATGCCGGCAGCGACCCGATCCTTCTCACGGCAAAATAGCACCACGAGT
CTGGGATCGCAGCCCGTCTCGGGGCGGACTCAGGGAGGGGGGTTCGAACCTACAGCGCAGTGGATTGACAGCTGG
CTCCCAGAGTTGCCGCTGCATTCCATCCTTACTCTTATCCAGCAGGTAACGAGCCTGGTTCCCGCCAGGGAAGCC
GTGTCGATGGATACGATCCGGCAAGTCCAGGAGATGGGCCTCGTTGGAGTCGAGCCGTCGCCGCCGCACGTGCAC
TCGTTTGAGTGGTCTCAGCCGGCGCTGGCCTGGTACGAGTCGCTCTTGTGGGGGATGATTTTCACGAGCGAGATG
CAGATTGCCAAGGGAACCATGGGCATGTGGAACGGCACATCGATCAAGCTCTTTCGTGTCCAGGAGACTGCGCCC
GAAGGCCCTACCTTGACGTCCCCTCGGGGAGCTGTCGATGCCGTGGGGAGCAACATCGTGTCCCGGATCGGCCAG
ATCAACCTCCGGGGCGGGCCAACGCAGGCCGGCGGCAACCCTCCGTCCAGGGCTGGGGTCTAG
Gene >Ophun1|652
ATGGGCGCCAGCGACTCCAAGATTGTCTTCAAGCAGGGAATCTTCAGGCTATCCGAGGAGCGTCACATCCCCGCG
GACGACACTTACTGGACCTCGGTTCGCAGCCGGTTATCGCCCAGCCGTGGGCGCTTTGCTGACGTGGTCTGCAGT
TTTGGGAGCTCCCAGAGTCGGCGGAAGATGTCTTTAGCCTATTCTCTCCTGCAGACATCCGACGCACCCGAGACC
AGGCTCTGGAAAACATCGAAACACTTGTGCTTGCGCTGACGTCGCGCCTCTTCATCCTCCGCCACCACCCCTCAT
TTCCCGACCCCGAACTGGCGCCCGAGCGAGACGCGCTGAACTGCGTCAGAATCCTGACACGGATTCTGCCTTACA
TCTACGAGAAAGAGAGCCTCAAGCCTTGGGAGGAACGGTTCTTCTGGGGAACGCGGCGCAAGAAAAGCCGCCGCG
CCGCCATCGCCAACGAGGTGCTGTTCGACGAGGCTCAGGACGGCAAGCAGGATGCGCCGGCCGAGAATGACGAGT
TCCTCGACGTCAAGCCCTTGGCCGAGGAGCTTATAGATACGCTGATAGACCTGCTTTTCTTTTCGGACCTGACCA
TTCCCCGTCAGCCCCATGGCCAGTCCAAGGTCACCTATGCCATCTGGCAAAGTGGCGTCGGCTGCAACTCGGCCG
TGGCAACGACGAAGGAGTTTGAAAACAACAGGTGTGAGATACTGCGGCTGCTCTTGGCCCTCGCCGGCCAGAGCA
TGTACTTCACACCAGGAGTCCTTCCGCAGAGGGGGGTTCGGACATTGACCTATCTCTGCACATGTCAGGAGAAGC
AGGTCGTGCTCTCCGTCCTGTGTTCGCTGCTGAACACGGTACGTTTGATCGAGCAAATCTTGTGGGTATCGCATC
TATATATACTGACCCCGGCAGACGCTCAAGTATAACCCTGCTAGCTGGCGAGTCCCGTACAACACGCTGGTGTTT
AGGGACCCGAAGCAGATACTTGTCACGTATTCCTTGCAACTCATGCTCGTTCTACTCGTCTATCCGATCCCAGAG
CAAGCTTCCGCGCAAAAGAATTTCTATCGACATTTCCTCGGCCGACTTCATCGCCCCCAGGATTTCCAGTTCATC
GTGGATGGCATCAGCCGCATCCTTAGCCAACCGTTGCAGGACAAGACGTCTTATCTGCCAGGACCTCAGACCTCG
GGAAACTTGACCCCGGAAATGCTGATGCTCTTTTGGGAGCTCACTCAGTGCAACAAGCGGTTCCGGTCCTTCATC
ATCGATACCGAGCGAGCCCACGATTTCGTCGTCTTGACGTTGTTTCATGCCTTGGAGTATAAGAGCGATCCGGCT
AAACAGGGAGTGGTTCGCATGTGTGCGTTCTTATTGCAAACGCTGAGCGTCGAGACCAACTTCGGTCACAATCTC
AACAAGCGTTTCGAAGGCCAGGAGAGCCTGCCCGCATGCATCAGGATCAACGGTTTCAACGGCTCTTATACCGAC
TTTCTCGTGCACTCCATCTACAGCCTGATAACCTCGAGCCAAGGCAACTTCGCCGCCGTGTATCCTGCTCTCTTG
GCCGTTATCAACAATATTGCACCGCACATCGAGGGACTGGGAGCCGCGGGCAGCTCTCAGCTCATGCTCTTGTTT
TCTTCCATGTCTTCGCCGTCGTTCCTTCTCGCGAACGAAACCAACCACACACTCCTCGACTCGCTCCTCGAGTCC
ATCAATAGCATCATCGAAACCAAGTATCGCGAGAACCCGGAGATGATGCTGGCAATCGTCAAGAGCCGGAAGCGG
ATCGAGGCTCTGCGGTCCTTTACTCTTGAGAGCGGCCAGGAAGAGCTGGAAAGAAGAAGTCGGAGAAGAAAAGAC
GGCGTCGGTCAGGGAGACGGTGCCGACACCGGGTCAGTCAGGAGCTCGGTCGACAGCGCAAGGAGCCCACCGCCT
GTACCGTCTCGACTGCCGACGCTGGGGCAGGTGCCCGAAGACAGCGCGTTCGCAATCGGCGATAACGAAGAGGAC
GATAGTGACGACGACCCGCAGCCGACGCCAGCGCCCTCCACCACCAGCGAGAACCAGTCTCAGGCATCTTCGGCC
GTGAACATGGAAGACGCGGTACCGACGCAGCTGCGCGGCATGTCGGAGAAGGCTCGCGGCAAGATGCCGGCAGCG
ACCCGATCCTTCTCACGGCAAAATAGCACCACGAGTCTGGGATCGCAGCCCGTCTCGGGGCGGACTCAGGGAGGG
GGGTTCGAACCTACAGCGCAGTGGATTGACAGCTGGCTCCCAGAGTTGCCGCTGCATTCCATCCTTACTCTTATC
CAGCAGGTAACGAGCCTGGTTCCCGCCAGGGAAGCCGTGTCGATGGATACGATCCGGCAAGTCCAGGAGATGGGC
CTCGTTGGAGTCGAGCCGTCGCCGCCGCACGTGCACTCGTTTGAGTGGTCTCAGCCGGCGCTGGCCTGGTACGAG
TCGCTCTTGTGGGGGATGATTTTCACGAGCGAGATGCAGATTGCCAAGGGAACCATGGGCATGTGGAACGGCACA
TCGATCAAGCTCTTTCGTGTCCAGGAGACTGCGCCCGAAGGCCCTACCTTGACGTCCCCTCGGGGAGCTGTCGAT
GCCGTGGGGAGCAACATCGTGTCCCGGATCGGCCAGATCAACCTCCGGGGCGGGCCAACGCAGGCCGGCGGCAAC
CCTCCGTCCAGGGCTGGGGTCTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail