Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6510
Gene name
LocationContig_713:5761..6913
Strand+
Gene length (bp)1152
Transcript length (bp)993
Coding sequence length (bp)993
Protein length (aa) 331

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 4.7E-14 77 246
PF13649 Methyltransf_25 Methyltransferase domain 1.1E-08 99 186
PF08241 Methyltransf_11 Methyltransferase domain 1.2E-06 100 189

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No
GO:0016741 transferase activity, transferring one-carbon groups No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup116
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|1824
Ophiocordyceps australis 1348a (Ghana) OphauG2|2470
Ophiocordyceps australis map64 (Brazil) OphauB2|3061
Ophiocordyceps australis map64 (Brazil) OphauB2|4472
Ophiocordyceps camponoti-floridani Ophcf2|00879
Ophiocordyceps camponoti-floridani Ophcf2|06995
Ophiocordyceps camponoti-rufipedis Ophun1|5295
Ophiocordyceps camponoti-rufipedis Ophun1|6510 (this protein)
Ophiocordyceps kimflemingae Ophio5|4284
Ophiocordyceps kimflemingae Ophio5|5055
Ophiocordyceps kimflemingae Ophio5|6669
Ophiocordyceps subramaniannii Hirsu2|3221
Ophiocordyceps subramaniannii Hirsu2|38
Ophiocordyceps subramaniannii Hirsu2|7756

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6510
MASPSFTQAPAIEVATQPGDDDEFDVNDDPFADGVTSITSSVYAHEYELGRRYHCFKNGRYPIPNDDIEKDREDL
KHAMLMELTDGVLFYAPVENPQLVLDIGTGTGIWAIEVGDRYPSAHVLGMDLTAIQPLWVPPNVEFLVDDCYQDW
LTEGTADLVHFRFMAVVLRDIATVLGHAFRSLRPGGWIEFHELHGEPLCDDGTMPPDDAFRRLYQLAGDAYSKFG
FSTTIAARLEPYLRAAGFVNVHCRVLRVPIGIWARDETLRLIGLYQKTAVLEFISTFAGRPFEALGISPEEVQVV
LALARRALEDGGVHRYFNYYFWYAQKPEGS*
Coding >Ophun1|6510
ATGGCCTCCCCTTCCTTTACGCAGGCACCCGCCATCGAAGTAGCCACCCAACCGGGCGACGACGACGAGTTCGAC
GTCAACGACGATCCCTTTGCCGATGGCGTCACCAGCATCACCTCGAGCGTCTACGCGCACGAGTACGAGCTCGGA
AGACGCTACCACTGCTTCAAGAACGGACGATATCCCATCCCCAACGATGACATTGAGAAGGATCGCGAGGATCTA
AAGCACGCCATGCTCATGGAACTCACCGACGGCGTCCTCTTCTACGCCCCCGTTGAGAACCCGCAGCTCGTGCTC
GACATTGGTACGGGGACGGGCATCTGGGCTATTGAAGTTGGCGATCGCTATCCTAGCGCCCATGTGCTGGGCATG
GACTTGACGGCCATTCAGCCGCTGTGGGTGCCGCCCAATGTCGAGTTCCTCGTCGACGACTGCTACCAGGATTGG
TTGACCGAGGGGACGGCCGATCTGGTGCACTTTCGATTCATGGCCGTGGTGCTACGCGATATCGCCACCGTTCTC
GGCCATGCCTTTCGGAGTCTTCGTCCCGGCGGCTGGATCGAATTCCACGAACTCCACGGCGAACCCTTATGCGAC
GACGGAACCATGCCCCCCGACGATGCCTTCCGCCGTCTCTACCAACTCGCCGGAGACGCCTACTCCAAGTTCGGC
TTCAGCACCACCATCGCCGCCCGTCTAGAGCCCTACCTCCGCGCCGCCGGCTTCGTCAACGTCCACTGCCGCGTG
CTGCGCGTCCCCATCGGCATCTGGGCGCGCGACGAGACGCTCCGCCTCATCGGGCTCTACCAGAAGACGGCCGTG
CTGGAATTCATCTCCACCTTTGCTGGGAGGCCGTTTGAGGCGCTGGGCATCTCGCCTGAGGAGGTGCAGGTTGTG
CTTGCGTTGGCGAGGAGGGCTTTGGAGGATGGGGGGGTGCATCGATACTTTAACTATTACTTTTGGTATGCGCAG
AAGCCCGAGGGGTCATGA
Transcript >Ophun1|6510
ATGGCCTCCCCTTCCTTTACGCAGGCACCCGCCATCGAAGTAGCCACCCAACCGGGCGACGACGACGAGTTCGAC
GTCAACGACGATCCCTTTGCCGATGGCGTCACCAGCATCACCTCGAGCGTCTACGCGCACGAGTACGAGCTCGGA
AGACGCTACCACTGCTTCAAGAACGGACGATATCCCATCCCCAACGATGACATTGAGAAGGATCGCGAGGATCTA
AAGCACGCCATGCTCATGGAACTCACCGACGGCGTCCTCTTCTACGCCCCCGTTGAGAACCCGCAGCTCGTGCTC
GACATTGGTACGGGGACGGGCATCTGGGCTATTGAAGTTGGCGATCGCTATCCTAGCGCCCATGTGCTGGGCATG
GACTTGACGGCCATTCAGCCGCTGTGGGTGCCGCCCAATGTCGAGTTCCTCGTCGACGACTGCTACCAGGATTGG
TTGACCGAGGGGACGGCCGATCTGGTGCACTTTCGATTCATGGCCGTGGTGCTACGCGATATCGCCACCGTTCTC
GGCCATGCCTTTCGGAGTCTTCGTCCCGGCGGCTGGATCGAATTCCACGAACTCCACGGCGAACCCTTATGCGAC
GACGGAACCATGCCCCCCGACGATGCCTTCCGCCGTCTCTACCAACTCGCCGGAGACGCCTACTCCAAGTTCGGC
TTCAGCACCACCATCGCCGCCCGTCTAGAGCCCTACCTCCGCGCCGCCGGCTTCGTCAACGTCCACTGCCGCGTG
CTGCGCGTCCCCATCGGCATCTGGGCGCGCGACGAGACGCTCCGCCTCATCGGGCTCTACCAGAAGACGGCCGTG
CTGGAATTCATCTCCACCTTTGCTGGGAGGCCGTTTGAGGCGCTGGGCATCTCGCCTGAGGAGGTGCAGGTTGTG
CTTGCGTTGGCGAGGAGGGCTTTGGAGGATGGGGGGGTGCATCGATACTTTAACTATTACTTTTGGTATGCGCAG
AAGCCCGAGGGGTCATGA
Gene >Ophun1|6510
ATGGCCTCCCCTTCCTTTACGCAGGCACCCGCCATCGAAGTAGCCACCCAACCGGGCGACGACGACGAGTTCGAC
GTCAACGACGATCCCTTTGCCGATGGCGTCACCAGCATCACCTCGAGCGTCTACGCGCACGAGTACGAGCTCGGA
AGACGCTACCACTGCTTCAAGAACGGACGATATCCCATCCCCAACGATGACATTGAGAAGGATCGCGAGGATCTA
AAGCACGCCATGCTCATGGAACTCACCGACGGCGTCCTCTTCTACGCCCCCGTTGAGAACCCGCAGCTCGTGCTC
GACATTGGTACGGGGACGGGCATCTGGGCTATTGAAGGTCCGTCTGCCCTTTTTCCCTTCCTTTCCCCCCCTTGC
TTGTCTTCTCGTCGTATCTTGGCCTGCCTACATGACGCCTCGTCTGGAGCGGCGAGTGTCTACCAATAGTTGGCG
ATCGCTATCCTAGCGCCCATGTGCTGGGCATGGACTTGACGGCCATTCAGCCGCTGTGGGTGCCGCCCAATGTCG
AGTTCCTCGTCGACGACTGCTACCAGGATTGGTTGACCGAGGGGACGGCCGATCTGGTGCACTTTCGATTCATGG
CCGTGGTGCTACGCGATATCGCCACCGTTCTCGGCCATGCCTTTCGGTAGGGGTTTTCCCCCCTTGGAAGGAATA
GAGGCGTGGCTAACGGCGACTAGGAGTCTTCGTCCCGGCGGCTGGATCGAATTCCACGAACTCCACGGCGAACCC
TTATGCGACGACGGAACCATGCCCCCCGACGATGCCTTCCGCCGTCTCTACCAACTCGCCGGAGACGCCTACTCC
AAGTTCGGCTTCAGCACCACCATCGCCGCCCGTCTAGAGCCCTACCTCCGCGCCGCCGGCTTCGTCAACGTCCAC
TGCCGCGTGCTGCGCGTCCCCATCGGCATCTGGGCGCGCGACGAGACGCTCCGCCTCATCGGGCTCTACCAGAAG
ACGGCCGTGCTGGAATTCATCTCCACCTTTGCTGGGAGGCCGTTTGAGGCGCTGGGCATCTCGCCTGAGGAGGTG
CAGGTTGTGCTTGCGTTGGCGAGGAGGGCTTTGGAGGATGGGGGGGTGCATCGATACTTTAACTATTACTTTTGG
TATGCGCAGAAGCCCGAGGGGTCATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail