Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6508
Gene name
LocationContig_713:2898..3669
Strand+
Gene length (bp)771
Transcript length (bp)771
Coding sequence length (bp)771
Protein length (aa) 257

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13468 Glyoxalase_3 Glyoxalase-like domain 2.6E-26 10 186

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup6749
Change Orthofinder run
Species Protein ID
Ophiocordyceps camponoti-rufipedis Ophun1|6508 (this protein)
Ophiocordyceps kimflemingae Ophio5|6671
Ophiocordyceps subramaniannii Hirsu2|7759

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6508
MDKARPRPILDHVVVLVTHDTLRSLEDRLKASLLVSPGGTHADGLTENKLIVLDDGSYIELIAFIDGIDPDRRRA
HRWGLVPENTAIDWAYTLPHESDFAGVQRRLGAAGVAYSHAEPGGRTLADGTDIKWAVAFPRDGPGRLPFWCLDR
TPRRLRVPSSAGTRHPCGARGVARLVVRTRPDDVTDLTKAYDALHGDEGDVRGRWSLDVCTGGRRFVTVEASESR
RGLEMVLLGGTASSIEVVAGLRLCIERETME*
Coding >Ophun1|6508
ATGGACAAGGCTCGTCCACGGCCAATCCTCGATCACGTCGTCGTCCTCGTCACCCACGATACGCTCCGCAGCCTG
GAAGACCGACTCAAGGCCTCGCTGCTCGTGTCACCAGGCGGGACGCACGCCGACGGCCTGACAGAGAACAAGCTG
ATTGTCTTGGACGACGGATCCTACATCGAGCTCATTGCCTTTATCGACGGCATCGACCCGGACCGCCGCAGAGCT
CATCGCTGGGGCCTCGTCCCGGAAAACACCGCCATCGACTGGGCCTACACGCTCCCTCACGAGAGCGACTTCGCC
GGCGTCCAGCGCAGGCTCGGAGCAGCCGGCGTGGCCTATTCCCATGCCGAGCCCGGGGGCCGTACCCTGGCAGAC
GGCACGGACATCAAGTGGGCCGTTGCTTTCCCCCGTGACGGGCCCGGTCGTCTTCCCTTTTGGTGTCTCGATCGG
ACGCCGCGCCGGCTCCGGGTGCCGTCCTCGGCCGGGACTCGGCATCCGTGTGGGGCCCGGGGGGTGGCTCGGCTG
GTAGTCCGGACGCGGCCCGACGACGTCACCGACCTGACGAAGGCGTACGATGCGCTTCACGGCGATGAGGGTGAT
GTGAGAGGACGCTGGTCACTTGACGTCTGTACCGGTGGCCGTCGGTTCGTTACTGTCGAAGCCAGCGAGTCGAGG
CGCGGCCTGGAGATGGTCCTACTGGGAGGAACAGCCTCTTCAATTGAGGTTGTGGCGGGATTGCGGCTGTGCATC
GAACGGGAAACGATGGAGTGA
Transcript >Ophun1|6508
ATGGACAAGGCTCGTCCACGGCCAATCCTCGATCACGTCGTCGTCCTCGTCACCCACGATACGCTCCGCAGCCTG
GAAGACCGACTCAAGGCCTCGCTGCTCGTGTCACCAGGCGGGACGCACGCCGACGGCCTGACAGAGAACAAGCTG
ATTGTCTTGGACGACGGATCCTACATCGAGCTCATTGCCTTTATCGACGGCATCGACCCGGACCGCCGCAGAGCT
CATCGCTGGGGCCTCGTCCCGGAAAACACCGCCATCGACTGGGCCTACACGCTCCCTCACGAGAGCGACTTCGCC
GGCGTCCAGCGCAGGCTCGGAGCAGCCGGCGTGGCCTATTCCCATGCCGAGCCCGGGGGCCGTACCCTGGCAGAC
GGCACGGACATCAAGTGGGCCGTTGCTTTCCCCCGTGACGGGCCCGGTCGTCTTCCCTTTTGGTGTCTCGATCGG
ACGCCGCGCCGGCTCCGGGTGCCGTCCTCGGCCGGGACTCGGCATCCGTGTGGGGCCCGGGGGGTGGCTCGGCTG
GTAGTCCGGACGCGGCCCGACGACGTCACCGACCTGACGAAGGCGTACGATGCGCTTCACGGCGATGAGGGTGAT
GTGAGAGGACGCTGGTCACTTGACGTCTGTACCGGTGGCCGTCGGTTCGTTACTGTCGAAGCCAGCGAGTCGAGG
CGCGGCCTGGAGATGGTCCTACTGGGAGGAACAGCCTCTTCAATTGAGGTTGTGGCGGGATTGCGGCTGTGCATC
GAACGGGAAACGATGGAGTGA
Gene >Ophun1|6508
ATGGACAAGGCTCGTCCACGGCCAATCCTCGATCACGTCGTCGTCCTCGTCACCCACGATACGCTCCGCAGCCTG
GAAGACCGACTCAAGGCCTCGCTGCTCGTGTCACCAGGCGGGACGCACGCCGACGGCCTGACAGAGAACAAGCTG
ATTGTCTTGGACGACGGATCCTACATCGAGCTCATTGCCTTTATCGACGGCATCGACCCGGACCGCCGCAGAGCT
CATCGCTGGGGCCTCGTCCCGGAAAACACCGCCATCGACTGGGCCTACACGCTCCCTCACGAGAGCGACTTCGCC
GGCGTCCAGCGCAGGCTCGGAGCAGCCGGCGTGGCCTATTCCCATGCCGAGCCCGGGGGCCGTACCCTGGCAGAC
GGCACGGACATCAAGTGGGCCGTTGCTTTCCCCCGTGACGGGCCCGGTCGTCTTCCCTTTTGGTGTCTCGATCGG
ACGCCGCGCCGGCTCCGGGTGCCGTCCTCGGCCGGGACTCGGCATCCGTGTGGGGCCCGGGGGGTGGCTCGGCTG
GTAGTCCGGACGCGGCCCGACGACGTCACCGACCTGACGAAGGCGTACGATGCGCTTCACGGCGATGAGGGTGAT
GTGAGAGGACGCTGGTCACTTGACGTCTGTACCGGTGGCCGTCGGTTCGTTACTGTCGAAGCCAGCGAGTCGAGG
CGCGGCCTGGAGATGGTCCTACTGGGAGGAACAGCCTCTTCAATTGAGGTTGTGGCGGGATTGCGGCTGTGCATC
GAACGGGAAACGATGGAGTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail