Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6505
Gene name
LocationContig_712:2019..4422
Strand-
Gene length (bp)2403
Transcript length (bp)2001
Coding sequence length (bp)2001
Protein length (aa) 667

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01591 6PF2K 6-phosphofructo-2-kinase 4.1E-17 138 190
PF01591 6PF2K 6-phosphofructo-2-kinase 1.5E-48 241 411
PF00300 His_Phos_1 Histidine phosphatase superfamily (branch 1) 9.0E-24 497 641

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 98 654 1.0E-146
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 67 654 3.0E-131
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 250 660 2.0E-97
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 144 658 1.0E-82
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 123 635 4.0E-74
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P40433|6P21_YEAST 6-phosphofructo-2-kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK26 PE=1 SV=1 98 654 1.0E-146
sp|Q8TFH0|YIKE_SCHPO Probable 6-phosphofructo-2-kinase PB17E12.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAPB17E12.14c PE=1 SV=2 67 654 3.0E-131
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 250 660 2.0E-97
sp|Q21122|F2612_CAEEL 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Caenorhabditis elegans GN=pfkb-1.2 PE=3 SV=2 144 658 1.0E-82
sp|P32604|F26_YEAST Fructose-2,6-bisphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=FBP26 PE=1 SV=2 123 635 4.0E-74
sp|Q91348|F26L_CHICK 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Gallus gallus PE=2 SV=2 253 636 2.0E-70
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 249 636 3.0E-70
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 249 644 3.0E-70
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 249 642 4.0E-70
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 249 636 6.0E-70
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 250 636 1.0E-69
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 250 636 1.0E-69
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 250 636 1.0E-69
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 249 644 3.0E-69
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 250 636 6.0E-68
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 249 636 7.0E-67
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 253 636 3.0E-66
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 212 636 5.0E-66
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 249 636 7.0E-66
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 249 636 8.0E-66
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 253 636 1.0E-65
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 249 636 2.0E-65
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 253 636 4.0E-65
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 253 636 3.0E-62
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 247 642 4.0E-61
sp|Q9URZ7|YK72_SCHPO Probable fructose-2,6-bisphosphatase C732.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC732.02c PE=3 SV=1 277 634 5.0E-45
sp|Q06137|YL345_YEAST Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase YLR345W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR345W PE=1 SV=1 212 634 5.0E-29
sp|Q9UTE1|YFMD_SCHPO Probable 6-phosphofructo-2-kinase C222.13c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC222.13c PE=3 SV=1 116 191 5.0E-11
sp|Q9UTK9|YIVH_SCHPO Putative 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase C144.17c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC144.17c PE=1 SV=2 265 419 3.0E-10
sp|Q12471|6P22_YEAST 6-phosphofructo-2-kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFK27 PE=1 SV=1 142 380 5.0E-10
sp|Q9MB58|F26_ARATH 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Arabidopsis thaliana GN=FKFBP PE=1 SV=1 143 215 8.0E-10
sp|Q5R9C1|F263_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Pongo abelii GN=PFKFB3 PE=2 SV=2 144 186 3.0E-09
sp|P70265|F262_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Mus musculus GN=Pfkfb2 PE=1 SV=2 112 186 3.0E-09
sp|Q16875|F263_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Homo sapiens GN=PFKFB3 PE=1 SV=1 144 186 3.0E-09
sp|O35552|F263_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 OS=Rattus norvegicus GN=Pfkfb3 PE=2 SV=1 144 186 3.0E-09
sp|Q91309|F26_LITCT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase OS=Lithobates catesbeiana PE=2 SV=1 144 186 1.0E-08
sp|Q28901|F263_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (Fragment) OS=Bos taurus GN=PFKFB3 PE=2 SV=2 144 189 2.0E-08
sp|Q9JJH5|F262_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Rattus norvegicus GN=Pfkfb2 PE=1 SV=1 112 186 2.0E-08
sp|P16118|F261_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Homo sapiens GN=PFKFB1 PE=1 SV=3 113 189 3.0E-08
sp|P49872|F261_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Bos taurus GN=PFKFB1 PE=2 SV=1 134 189 6.0E-08
sp|P07953|F261_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Rattus norvegicus GN=Pfkfb1 PE=1 SV=3 113 189 6.0E-08
sp|Q6DTY7|F264_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Mus musculus GN=Pfkfb4 PE=2 SV=4 144 183 7.0E-08
sp|Q4R8B6|F264_MACFA 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Macaca fascicularis GN=PFKFB4 PE=2 SV=3 144 184 7.0E-08
sp|P26285|F262_BOVIN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Bos taurus GN=PFKFB2 PE=1 SV=2 144 186 7.0E-08
sp|P25114|F264_RAT 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Rattus norvegicus GN=Pfkfb4 PE=1 SV=3 144 183 8.0E-08
sp|Q16877|F264_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 4 OS=Homo sapiens GN=PFKFB4 PE=2 SV=6 144 183 8.0E-08
sp|O60825|F262_HUMAN 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Homo sapiens GN=PFKFB2 PE=1 SV=2 144 186 8.0E-08
sp|Q5NVT1|F262_PONAB 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 2 OS=Pongo abelii GN=PFKFB2 PE=2 SV=1 144 186 9.0E-08
sp|P70266|F261_MOUSE 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 1 OS=Mus musculus GN=Pfkfb1 PE=1 SV=2 134 189 1.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0006000 fructose metabolic process Yes
GO:0005524 ATP binding Yes
GO:0003873 6-phosphofructo-2-kinase activity Yes
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0030554 adenyl nucleotide binding No
GO:0032559 adenyl ribonucleotide binding No
GO:0016740 transferase activity No
GO:0016301 kinase activity No
GO:0019318 hexose metabolic process No
GO:0097159 organic cyclic compound binding No
GO:0008152 metabolic process No
GO:0035639 purine ribonucleoside triphosphate binding No
GO:0097367 carbohydrate derivative binding No
GO:0003824 catalytic activity No
GO:0036094 small molecule binding No
GO:1901363 heterocyclic compound binding No
GO:0005996 monosaccharide metabolic process No
GO:0032555 purine ribonucleotide binding No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0017076 purine nucleotide binding No
GO:0043167 ion binding No
GO:0032553 ribonucleotide binding No
GO:0003674 molecular_function No
GO:0019200 carbohydrate kinase activity No
GO:0008443 phosphofructokinase activity No
GO:1901265 nucleoside phosphate binding No
GO:0043168 anion binding No
GO:0008150 biological_process No
GO:0005975 carbohydrate metabolic process No
GO:0005488 binding No
GO:0044238 primary metabolic process No
GO:0044281 small molecule metabolic process No
GO:0071704 organic substance metabolic process No
GO:0000166 nucleotide binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3907
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4122
Ophiocordyceps australis map64 (Brazil) OphauB2|7677
Ophiocordyceps camponoti-floridani Ophcf2|00493
Ophiocordyceps camponoti-rufipedis Ophun1|6505 (this protein)
Ophiocordyceps kimflemingae Ophio5|8196
Ophiocordyceps subramaniannii Hirsu2|7784

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6505
MPSAIVIPRQDVGNKQAKQSALAQQIMQNSLASSTSSSFPDPDRNLAVLSPFASRHDLFPSASSSASAINQTVRS
VKDLTDTPPLSHSVTSTAPNSPRMQRRNSGSQTPRVRPHATTLNIPGMTRSRVSPDGRIPQRDVAAKLVIVMVGL
PARGKSYITKKLQRYLSWQQHDSRIFNVGNRRRHAAGVKVSAKERLAPEPYRLDPPVQAATILLQGTPVPDDTLN
TDSIEPTTLNLNGAPDEFHDELDQSANFFDPHNEKASAMRNQVAMETLDELLDYMLNQGGAVGIFDATNSTIRRR
QTIVDRIRKREPKLGILFIESICRDQQLLEANMRLKLSGPDYRDKDPHKSLEDFKNRVAAYASAYEPLGEYEEDN
DMQYIQLVDVGRKLVQHRLKGFLSGGISTYLSSFNLAPRQIWMTRHGQSVDNELGKLGGNSPLTERGHCYGQALY
RFMTHKREQWLMEQKSKMAQASFPPLPGDNTPPYPDMNQDLDEKNFCVWTSMLQRSVETAEYFDADDDYDVKNWE
MLNELNAGEFEGMTYKEIASRYPDEFSRRSEDKLNYIYPGVGGEGYLQVISRLRDMVREIERITDHVLIIGHRSV
CRVLMAYFMDLTREDITDMDVPLGMLYSIEPKPYGIAFHAYKYDEAQGWFEELPNYKPQKAARGSI*
Coding >Ophun1|6505
ATGCCCTCCGCCATCGTCATTCCCCGCCAAGACGTGGGCAACAAACAGGCGAAGCAGTCGGCTCTGGCCCAGCAA
ATCATGCAAAACTCGCTGGCCTCGTCCACCTCCTCGTCGTTTCCCGATCCGGACCGCAACCTTGCCGTTCTGTCG
CCCTTTGCTTCCCGCCATGATCTCTTCCCCAGCGCCTCCTCCTCGGCCTCGGCCATCAACCAGACGGTTCGTTCT
GTCAAGGACCTGACCGACACGCCTCCCCTGTCGCACAGCGTCACCTCGACCGCCCCCAACTCGCCTCGCATGCAA
CGCCGGAACTCGGGCAGCCAGACGCCCCGTGTGCGGCCGCACGCTACAACGCTCAATATCCCCGGCATGACCAGG
TCCAGAGTCTCCCCCGACGGGAGGATCCCTCAGCGTGACGTGGCCGCGAAGCTCGTCATCGTCATGGTCGGCCTG
CCCGCCCGCGGAAAGTCGTACATCACCAAGAAGCTACAGCGCTACCTCTCCTGGCAGCAACACGACTCTCGCATA
TTCAACGTCGGCAACCGCCGCCGTCACGCCGCCGGTGTCAAGGTCTCGGCCAAGGAGAGGCTAGCCCCCGAACCC
TACCGTCTCGACCCCCCCGTCCAGGCGGCCACCATCCTACTTCAGGGCACGCCCGTACCGGACGACACCCTCAAC
ACGGACTCTATCGAGCCCACCACGTTGAACCTCAATGGAGCCCCTGACGAGTTTCACGATGAGCTCGACCAATCT
GCCAACTTCTTTGATCCCCACAACGAAAAGGCGTCTGCCATGCGGAACCAGGTCGCCATGGAGACGCTCGACGAA
CTACTCGACTATATGCTGAACCAAGGCGGCGCAGTGGGCATCTTTGACGCCACCAACAGCACCATCAGGAGGAGG
CAAACGATTGTCGACCGCATCCGGAAGCGCGAGCCAAAACTCGGCATCCTCTTCATCGAGAGCATCTGCAGGGAC
CAACAACTGCTCGAGGCCAACATGCGCCTCAAGCTCTCCGGCCCAGACTATCGCGACAAAGATCCCCACAAATCG
CTTGAGGACTTCAAGAATCGAGTCGCCGCCTACGCCAGCGCGTACGAGCCCCTCGGCGAGTACGAGGAGGACAAT
GACATGCAGTACATTCAGCTGGTGGATGTCGGCAGGAAGCTGGTGCAGCATAGACTCAAGGGCTTCCTCAGCGGC
GGTATCAGCACCTATCTCTCCAGTTTCAACCTCGCACCCAGGCAGATCTGGATGACGCGCCACGGACAGAGCGTC
GACAACGAGCTCGGCAAACTGGGTGGCAACTCCCCCTTGACGGAACGAGGCCACTGCTACGGCCAGGCGCTCTAC
CGATTCATGACGCACAAGCGCGAGCAGTGGCTGATGGAGCAGAAGAGCAAGATGGCTCAGGCCTCGTTCCCGCCC
TTGCCGGGTGACAACACGCCTCCCTACCCGGACATGAACCAGGATCTGGACGAAAAGAACTTTTGCGTCTGGACA
TCGATGCTGCAGCGTAGCGTCGAAACGGCCGAGTATTTCGACGCCGATGACGACTACGACGTCAAGAACTGGGAG
ATGCTGAACGAGCTCAACGCCGGCGAGTTTGAGGGCATGACATACAAGGAGATTGCCTCTCGCTACCCAGACGAG
TTTTCCAGGCGATCCGAGGACAAGCTCAACTACATCTACCCGGGCGTTGGCGGCGAGGGCTATCTTCAGGTCATC
AGCCGACTGCGGGACATGGTGCGCGAGATTGAGCGCATCACCGATCACGTCCTCATCATTGGACACCGGTCTGTG
TGCCGGGTGCTGATGGCCTACTTTATGGACCTGACGCGCGAAGACATCACCGACATGGACGTGCCCCTGGGCATG
CTGTACTCGATTGAACCGAAGCCTTACGGCATCGCCTTCCACGCCTACAAGTACGATGAGGCTCAAGGCTGGTTC
GAGGAGCTTCCCAACTACAAGCCGCAGAAGGCGGCCCGCGGTAGCATCTGA
Transcript >Ophun1|6505
ATGCCCTCCGCCATCGTCATTCCCCGCCAAGACGTGGGCAACAAACAGGCGAAGCAGTCGGCTCTGGCCCAGCAA
ATCATGCAAAACTCGCTGGCCTCGTCCACCTCCTCGTCGTTTCCCGATCCGGACCGCAACCTTGCCGTTCTGTCG
CCCTTTGCTTCCCGCCATGATCTCTTCCCCAGCGCCTCCTCCTCGGCCTCGGCCATCAACCAGACGGTTCGTTCT
GTCAAGGACCTGACCGACACGCCTCCCCTGTCGCACAGCGTCACCTCGACCGCCCCCAACTCGCCTCGCATGCAA
CGCCGGAACTCGGGCAGCCAGACGCCCCGTGTGCGGCCGCACGCTACAACGCTCAATATCCCCGGCATGACCAGG
TCCAGAGTCTCCCCCGACGGGAGGATCCCTCAGCGTGACGTGGCCGCGAAGCTCGTCATCGTCATGGTCGGCCTG
CCCGCCCGCGGAAAGTCGTACATCACCAAGAAGCTACAGCGCTACCTCTCCTGGCAGCAACACGACTCTCGCATA
TTCAACGTCGGCAACCGCCGCCGTCACGCCGCCGGTGTCAAGGTCTCGGCCAAGGAGAGGCTAGCCCCCGAACCC
TACCGTCTCGACCCCCCCGTCCAGGCGGCCACCATCCTACTTCAGGGCACGCCCGTACCGGACGACACCCTCAAC
ACGGACTCTATCGAGCCCACCACGTTGAACCTCAATGGAGCCCCTGACGAGTTTCACGATGAGCTCGACCAATCT
GCCAACTTCTTTGATCCCCACAACGAAAAGGCGTCTGCCATGCGGAACCAGGTCGCCATGGAGACGCTCGACGAA
CTACTCGACTATATGCTGAACCAAGGCGGCGCAGTGGGCATCTTTGACGCCACCAACAGCACCATCAGGAGGAGG
CAAACGATTGTCGACCGCATCCGGAAGCGCGAGCCAAAACTCGGCATCCTCTTCATCGAGAGCATCTGCAGGGAC
CAACAACTGCTCGAGGCCAACATGCGCCTCAAGCTCTCCGGCCCAGACTATCGCGACAAAGATCCCCACAAATCG
CTTGAGGACTTCAAGAATCGAGTCGCCGCCTACGCCAGCGCGTACGAGCCCCTCGGCGAGTACGAGGAGGACAAT
GACATGCAGTACATTCAGCTGGTGGATGTCGGCAGGAAGCTGGTGCAGCATAGACTCAAGGGCTTCCTCAGCGGC
GGTATCAGCACCTATCTCTCCAGTTTCAACCTCGCACCCAGGCAGATCTGGATGACGCGCCACGGACAGAGCGTC
GACAACGAGCTCGGCAAACTGGGTGGCAACTCCCCCTTGACGGAACGAGGCCACTGCTACGGCCAGGCGCTCTAC
CGATTCATGACGCACAAGCGCGAGCAGTGGCTGATGGAGCAGAAGAGCAAGATGGCTCAGGCCTCGTTCCCGCCC
TTGCCGGGTGACAACACGCCTCCCTACCCGGACATGAACCAGGATCTGGACGAAAAGAACTTTTGCGTCTGGACA
TCGATGCTGCAGCGTAGCGTCGAAACGGCCGAGTATTTCGACGCCGATGACGACTACGACGTCAAGAACTGGGAG
ATGCTGAACGAGCTCAACGCCGGCGAGTTTGAGGGCATGACATACAAGGAGATTGCCTCTCGCTACCCAGACGAG
TTTTCCAGGCGATCCGAGGACAAGCTCAACTACATCTACCCGGGCGTTGGCGGCGAGGGCTATCTTCAGGTCATC
AGCCGACTGCGGGACATGGTGCGCGAGATTGAGCGCATCACCGATCACGTCCTCATCATTGGACACCGGTCTGTG
TGCCGGGTGCTGATGGCCTACTTTATGGACCTGACGCGCGAAGACATCACCGACATGGACGTGCCCCTGGGCATG
CTGTACTCGATTGAACCGAAGCCTTACGGCATCGCCTTCCACGCCTACAAGTACGATGAGGCTCAAGGCTGGTTC
GAGGAGCTTCCCAACTACAAGCCGCAGAAGGCGGCCCGCGGTAGCATCTGA
Gene >Ophun1|6505
ATGCCCTCCGCCATCGTCATTCCCCGCCAAGGTTAGTGGCCAGGCGCCAATCCTTACCCCTCCAGGGCCCTTCTC
TTCCACCATCATCTTGATTCGCGTGGCATCGTGGCCACCTATCGTCATAGCCTCGACATTGCTCGCCTGTCTTGT
TCCTCCTCTCCTTTTCTCCCTACTACCTGTCTCTTACTCACTACTCCCTACTTCCCTACACCCTCTTTGTCTTTG
CTCGCTCTTATCTCTGCCCCTCCTCTCGGCCTCTACGTCGCCACGCACAACTCGACCGACGATCCTCCGCTAACT
CTTGGCCAGACGTGGGCAACAAACAGGCGAAGCAGTCGGCTCTGGCCCAGCAAATCATGCAAAACTCGCTGGCCT
CGTCCACCTCCTCGTCGTTTCCCGATCCGGACCGCAACCTTGCCGTTCTGTCGCCCTTTGCTTCCCGCCATGATC
TCTTCCCCAGCGCCTCCTCCTCGGCCTCGGCCATCAACCAGACGGTTCGTTCTGTCAAGGACCTGACCGACACGC
CTCCCCTGTCGCACAGCGTCACCTCGACCGCCCCCAACTCGCCTCGCATGCAAGTCTACCTACCACGGCCTGGAA
ATGCCCCTTGGCTGTTTTGCTGACACGGTTACTCAGGCCCCCTCAGCGCCGGAACTCGGGCAGCCAGACGCCCCG
TGTGCGGCCGCACGCTACAACGCTCAATATCCCCGGCATGACCAGGTCCAGAGTCTCCCCCGACGGGAGGATCCC
TCAGCGTGACGTGGCCGCGAAGCTCGTCATCGTCATGGTCGGCCTGCCCGCCCGCGGAAAGTCGTACATCACCAA
GAAGCTACAGCGCTACCTCTCCTGGCAGCAACACGACTCTCGCATATTCAACGTCGGCAACCGCCGCCGTCACGC
CGCCGGTGTCAAGGTCTCGGCCAAGGAGAGGCTAGCCCCCGAACCCTACCGTCTCGACCCCCCCGTCCAGGCGGC
CACCATCCTACTTCAGGGCACGCCCGTACCGGACGACACCCTCAACACGGACTCTATCGAGCCCACCACGTTGAA
CCTCAATGGAGCCCCTGACGAGTTTCACGATGAGCTCGACCAATCTGCCAACTTCTTTGATCCCCACAACGAAAA
GGCGTCTGCCATGCGGAACCAGGTCGCCATGGAGACGCTCGACGAACTACTCGACTATATGCTGAACCAAGGCGG
CGCAGTGGGCATCTTTGACGCCACCAACAGCACCATCAGGAGGAGGCAAACGATTGTCGACCGCATCCGGAAGCG
CGAGCCAAAACTCGGCATCCTCTTCATCGAGAGCATCTGCAGGGACCAACAACTGCTCGAGGCCAACATGCGCCT
CAAGCTCTCCGGCCCAGACTATCGCGACAAAGATCCCCACAAATCGCTTGAGGACTTCAAGAATCGAGTCGCCGC
CTACGCCAGCGCGTACGAGCCCCTCGGCGAGTACGAGGAGGACAATGACATGCAGTACATTCAGGTTCGCCCCCA
TACCGCGGCTCTCACCAAGCCCGTCTCTTGCTGACCCGACTCAAGCTGGTGGATGTCGGCAGGAAGCTGGTGCAG
CATAGACTCAAGGGCTTCCTCAGCGGCGGTATCAGCACCTATCTCTCCAGTTTCAACCTCGCACCCAGGCAGATC
TGGATGACGCGCCACGGACAGAGCGTCGACAACGAGCTCGGCAAACTGGGTGGCAACTCCCCCTTGACGGAACGA
GGCCACTGCTACGGCCAGGCGCTCTACCGATTCATGACGCACAAGCGCGAGCAGTGGCTGATGGAGCAGAAGAGC
AAGATGGCTCAGGCCTCGTTCCCGCCCTTGCCGGGTGACAACACGCCTCCCTACCCGGACATGAACCAGGATCTG
GACGAAAAGAACTTTTGCGTCTGGACATCGATGCTGCAGCGTAGCGTCGAAACGGCCGAGTATTTCGACGCCGAT
GACGACTACGACGTCAAGAACTGGGAGATGCTGAACGAGCTCAACGCCGGCGAGTTTGAGGGCATGACATACAAG
GAGATTGCCTCTCGCTACCCAGACGAGTTTTCCAGGCGATCCGAGGACAAGCTCAACTACATCTACCCGGGCGTT
GGCGGCGAGGGCTATCTTCAGGTCATCAGCCGACTGCGGGACATGGTGCGCGAGATTGAGCGCATCACCGATCAC
GTCCTCATCATTGGACACCGGTCTGTGTGCCGGGTGCTGATGGCCTACTTTATGGACCTGACGCGCGAAGACATC
ACCGACATGGACGTGCCCCTGGGCATGCTGTACTCGATTGAACCGAAGCCTTACGGCATCGCCTTCCACGCCTAC
AAGTACGATGAGGCTCAAGGCTGGTTCGAGGAGCTTCCCAACTACAAGCCGCAGAAGGCGGCCCGCGGTAGCATC
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail