Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6504
Gene name
LocationContig_712:85..1444
Strand+
Gene length (bp)1359
Transcript length (bp)1359
Coding sequence length (bp)1359
Protein length (aa) 453

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00400 WD40 WD domain, G-beta repeat 2.8E-03 63 95
PF00400 WD40 WD domain, G-beta repeat 2.7E-02 112 142
PF00400 WD40 WD domain, G-beta repeat 1.5E-01 205 232
PF00400 WD40 WD domain, G-beta repeat 2.6E-05 282 317
PF00400 WD40 WD domain, G-beta repeat 5.4E-06 328 359
PF04158 Sof1 Sof1-like domain 2.6E-30 361 447
PF12894 ANAPC4_WD40 Anaphase-promoting complex subunit 4 WD40 domain 2.1E-04 104 144

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74340|DCA13_SCHPO Protein sof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sof1 PE=3 SV=1 1 448 7.0E-155
sp|P33750|DCA13_YEAST Protein SOF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOF1 PE=1 SV=1 1 433 2.0E-144
sp|Q7ZYQ6|DCA13_XENLA DDB1- and CUL4-associated factor 13 OS=Xenopus laevis GN=dcaf13 PE=2 SV=1 1 448 8.0E-118
sp|Q803X4|DCA13_DANRE DDB1- and CUL4-associated factor 13 OS=Danio rerio GN=dcaf13 PE=2 SV=1 1 448 1.0E-116
sp|Q5ZLK1|DCA13_CHICK DDB1- and CUL4-associated factor 13 OS=Gallus gallus GN=DCAF13 PE=2 SV=1 1 433 1.0E-116
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74340|DCA13_SCHPO Protein sof1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=sof1 PE=3 SV=1 1 448 7.0E-155
sp|P33750|DCA13_YEAST Protein SOF1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOF1 PE=1 SV=1 1 433 2.0E-144
sp|Q7ZYQ6|DCA13_XENLA DDB1- and CUL4-associated factor 13 OS=Xenopus laevis GN=dcaf13 PE=2 SV=1 1 448 8.0E-118
sp|Q803X4|DCA13_DANRE DDB1- and CUL4-associated factor 13 OS=Danio rerio GN=dcaf13 PE=2 SV=1 1 448 1.0E-116
sp|Q5ZLK1|DCA13_CHICK DDB1- and CUL4-associated factor 13 OS=Gallus gallus GN=DCAF13 PE=2 SV=1 1 433 1.0E-116
sp|Q6NVS5|DCA13_XENTR DDB1- and CUL4-associated factor 13 OS=Xenopus tropicalis GN=dcaf13 PE=2 SV=1 1 448 1.0E-116
sp|Q6PAC3|DCA13_MOUSE DDB1- and CUL4-associated factor 13 OS=Mus musculus GN=Dcaf13 PE=2 SV=2 1 448 1.0E-115
sp|Q7KWL3|DCA13_DICDI DDB1- and CUL4-associated factor 13 OS=Dictyostelium discoideum GN=wdsof1 PE=3 SV=1 1 427 2.0E-112
sp|Q9NV06|DCA13_HUMAN DDB1- and CUL4-associated factor 13 OS=Homo sapiens GN=DCAF13 PE=1 SV=2 1 433 3.0E-111
sp|Q5R4T8|DCA13_PONAB DDB1- and CUL4-associated factor 13 OS=Pongo abelii GN=DCAF13 PE=2 SV=1 1 433 3.0E-110
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 64 373 2.0E-22
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 63 393 4.0E-19
sp|Q9QXE7|TBL1X_MOUSE F-box-like/WD repeat-containing protein TBL1X OS=Mus musculus GN=Tbl1x PE=1 SV=2 63 363 1.0E-18
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 63 363 3.0E-18
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 63 363 3.0E-18
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 63 362 4.0E-18
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 63 362 5.0E-18
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 63 362 7.0E-18
sp|Q9BQ87|TBL1Y_HUMAN F-box-like/WD repeat-containing protein TBL1Y OS=Homo sapiens GN=TBL1Y PE=2 SV=1 63 363 9.0E-18
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 63 362 9.0E-18
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 64 361 1.0E-17
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 63 365 2.0E-17
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 63 365 3.0E-17
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 63 365 6.0E-16
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 60 386 1.0E-15
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 64 359 3.0E-15
sp|Q00808|HETE1_PODAS Vegetative incompatibility protein HET-E-1 OS=Podospora anserina GN=HET-E1 PE=3 SV=1 60 398 3.0E-15
sp|F6ZT52|POC1B_XENTR POC1 centriolar protein homolog B OS=Xenopus tropicalis GN=poc1b PE=2 SV=1 63 400 3.0E-15
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 204 360 4.0E-15
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 45 359 4.0E-15
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 63 379 7.0E-15
sp|D3ZW91|POC1B_RAT POC1 centriolar protein homolog B OS=Rattus norvegicus GN=Poc1b PE=3 SV=1 56 392 7.0E-15
sp|Q4V7Z1|POC1B_XENLA POC1 centriolar protein homolog B OS=Xenopus laevis GN=poc1b PE=1 SV=1 63 400 1.0E-14
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 64 363 1.0E-14
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 64 362 2.0E-14
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 64 362 3.0E-14
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 47 336 4.0E-14
sp|Q8BHD1|POC1B_MOUSE POC1 centriolar protein homolog B OS=Mus musculus GN=Poc1b PE=2 SV=1 56 402 4.0E-14
sp|G0SC29|NLE1_CHATD Ribosome assembly protein 4 OS=Chaetomium thermophilum (strain DSM 1495 / CBS 144.50 / IMI 039719) GN=CTHT_0055700 PE=1 SV=2 51 365 5.0E-14
sp|Q8IZU2|WDR17_HUMAN WD repeat-containing protein 17 OS=Homo sapiens GN=WDR17 PE=2 SV=2 64 363 8.0E-14
sp|Q7SZM9|TB1RA_XENLA F-box-like/WD repeat-containing protein TBL1XR1-A OS=Xenopus laevis GN=tbl1xr1-a PE=1 SV=1 82 356 1.0E-13
sp|Q6GPC6|TB1RB_XENLA F-box-like/WD repeat-containing protein TBL1XR1-B OS=Xenopus laevis GN=tbl1xr1-b PE=2 SV=1 82 356 1.0E-13
sp|Q8K450|SPG16_MOUSE Sperm-associated antigen 16 protein OS=Mus musculus GN=Spag16 PE=1 SV=1 30 316 1.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 64 360 2.0E-13
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 63 363 2.0E-13
sp|Q8BHJ5|TBL1R_MOUSE F-box-like/WD repeat-containing protein TBL1XR1 OS=Mus musculus GN=Tbl1xr1 PE=1 SV=1 82 356 3.0E-13
sp|Q9BZK7|TBL1R_HUMAN F-box-like/WD repeat-containing protein TBL1XR1 OS=Homo sapiens GN=TBL1XR1 PE=1 SV=1 82 356 3.0E-13
sp|Q8YV57|Y2124_NOSS1 Uncharacterized WD repeat-containing protein all2124 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=all2124 PE=3 SV=1 68 343 5.0E-13
sp|P43254|COP1_ARATH E3 ubiquitin-protein ligase COP1 OS=Arabidopsis thaliana GN=COP1 PE=1 SV=2 105 316 6.0E-13
sp|C4YFX2|TUP1_CANAW Transcriptional repressor TUP1 OS=Candida albicans (strain WO-1) GN=TUP1 PE=3 SV=1 109 378 6.0E-13
sp|P0CY34|TUP1_CANAL Transcriptional repressor TUP1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TUP1 PE=2 SV=1 109 378 6.0E-13
sp|Q95RJ9|EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster GN=ebi PE=1 SV=2 82 356 7.0E-13
sp|O60907|TBL1X_HUMAN F-box-like/WD repeat-containing protein TBL1X OS=Homo sapiens GN=TBL1X PE=1 SV=3 82 356 8.0E-13
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 63 374 8.0E-13
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 60 360 1.0E-12
sp|Q4R8H1|TBL1X_MACFA F-box-like/WD repeat-containing protein TBL1X OS=Macaca fascicularis GN=TBL1X PE=2 SV=1 82 356 2.0E-12
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 56 365 2.0E-12
sp|Q9D0I6|WSDU1_MOUSE WD repeat, SAM and U-box domain-containing protein 1 OS=Mus musculus GN=Wdsub1 PE=2 SV=1 249 362 2.0E-12
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 205 397 4.0E-12
sp|O14727|APAF_HUMAN Apoptotic protease-activating factor 1 OS=Homo sapiens GN=APAF1 PE=1 SV=2 63 398 6.0E-12
sp|Q6CSI1|HAT2_KLULA Histone acetyltransferase type B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAT2 PE=3 SV=1 160 375 9.0E-12
sp|Q9UUG8|TUP12_SCHPO Transcriptional repressor tup12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup12 PE=1 SV=2 223 364 1.0E-11
sp|Q5FVN8|WSDU1_RAT WD repeat, SAM and U-box domain-containing protein 1 OS=Rattus norvegicus GN=Wdsub1 PE=2 SV=1 261 363 1.0E-11
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 88 359 1.0E-11
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 64 365 1.0E-11
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 80 365 2.0E-11
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 64 367 2.0E-11
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 60 360 2.0E-11
sp|B5X9P2|CIO1A_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-A OS=Salmo salar GN=ciao1a PE=2 SV=1 209 360 2.0E-11
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 204 421 2.0E-11
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 60 360 2.0E-11
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 204 382 3.0E-11
sp|O76071|CIAO1_HUMAN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Homo sapiens GN=CIAO1 PE=1 SV=1 187 398 3.0E-11
sp|B5X212|CIO1B_SALSA Probable cytosolic iron-sulfur protein assembly protein ciao1-B OS=Salmo salar GN=ciao1b PE=2 SV=1 209 360 3.0E-11
sp|Q7ZVL2|WDR24_DANRE WD repeat-containing protein 24 OS=Danio rerio GN=wdr24 PE=2 SV=1 175 392 4.0E-11
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 64 365 5.0E-11
sp|Q7ZX22|WDR24_XENLA WD repeat-containing protein 24 OS=Xenopus laevis GN=wdr24 PE=2 SV=1 175 394 5.0E-11
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 64 365 5.0E-11
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 204 359 6.0E-11
sp|Q93847|YZLL_CAEEL Uncharacterized WD repeat-containing protein K04G11.4 OS=Caenorhabditis elegans GN=K04G11.4 PE=3 SV=1 205 359 6.0E-11
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 82 351 7.0E-11
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 204 421 7.0E-11
sp|O94244|HAT2_SCHPO Histone acetyltransferase type B subunit 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mis16 PE=1 SV=1 203 359 8.0E-11
sp|O22469|MSI3_ARATH WD-40 repeat-containing protein MSI3 OS=Arabidopsis thaliana GN=MSI3 PE=1 SV=2 206 364 9.0E-11
sp|Q5ZMV9|WDR24_CHICK WD repeat-containing protein 24 OS=Gallus gallus GN=WDR24 PE=2 SV=1 175 392 1.0E-10
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 204 365 1.0E-10
sp|Q32PJ6|CIAO1_BOVIN Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Bos taurus GN=CIAO1 PE=2 SV=1 209 398 1.0E-10
sp|Q23256|WDR53_CAEEL WD repeat-containing protein wdr-5.3 OS=Caenorhabditis elegans GN=wdr-5.3 PE=3 SV=1 71 365 1.0E-10
sp|Q91WQ5|TAF5L_MOUSE TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Mus musculus GN=Taf5l PE=2 SV=1 215 359 1.0E-10
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 60 360 2.0E-10
sp|Q3Y8L7|DAW1_CHLRE Dynein assembly factor with WDR repeat domains 1 OS=Chlamydomonas reinhardtii GN=DAW1 PE=1 SV=1 21 382 2.0E-10
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 215 359 2.0E-10
sp|Q54SD4|RBBD_DICDI Probable histone-binding protein rbbD OS=Dictyostelium discoideum GN=rbbD PE=3 SV=1 174 360 2.0E-10
sp|P90917|RBA1_CAEEL Probable histone-binding protein rba-1 OS=Caenorhabditis elegans GN=rba-1 PE=3 SV=1 208 370 2.0E-10
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 64 316 2.0E-10
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 64 405 2.0E-10
sp|Q6P0D9|CIAO1_DANRE Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Danio rerio GN=ciao1 PE=2 SV=1 209 398 2.0E-10
sp|Q8CFJ9|WDR24_MOUSE WD repeat-containing protein 24 OS=Mus musculus GN=Wdr24 PE=1 SV=1 176 394 2.0E-10
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 204 382 2.0E-10
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 218 359 2.0E-10
sp|Q28I85|POC1A_XENTR POC1 centriolar protein homolog A OS=Xenopus tropicalis GN=poc1a PE=2 SV=1 63 401 3.0E-10
sp|Q9EPV5|APAF_RAT Apoptotic protease-activating factor 1 OS=Rattus norvegicus GN=Apaf1 PE=1 SV=1 63 369 3.0E-10
sp|P93471|COP1_PEA E3 ubiquitin-protein ligase COP1 OS=Pisum sativum GN=COP1 PE=2 SV=1 105 316 4.0E-10
sp|B6K1G6|CFD1_SCHJY Probable cytosolic Fe-S cluster assembly factor SJAG_02895 OS=Schizosaccharomyces japonicus (strain yFS275 / FY16936) GN=SJAG_02895 PE=3 SV=2 205 371 4.0E-10
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 112 408 4.0E-10
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 205 359 5.0E-10
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 204 381 5.0E-10
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 204 382 6.0E-10
sp|P56094|TUP1_KLULA General transcriptional corepressor TUP1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TUP1 PE=1 SV=2 219 363 7.0E-10
sp|Q7RY30|LIS11_NEUCR Nuclear distribution protein nudF-2 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-1 PE=3 SV=2 204 359 7.0E-10
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 63 386 1.0E-09
sp|A8X8C6|TG125_CAEBR WD repeat-containing protein tag-125 OS=Caenorhabditis briggsae GN=tag-125 PE=3 SV=1 112 383 1.0E-09
sp|Q8N0X2|SPG16_HUMAN Sperm-associated antigen 16 protein OS=Homo sapiens GN=SPAG16 PE=2 SV=2 62 317 1.0E-09
sp|D1ZEB4|LIS11_SORMK Nuclear distribution protein PAC1-1 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-1 PE=3 SV=1 204 359 1.0E-09
sp|Q4P553|HAT2_USTMA Histone acetyltransferase type B subunit 2 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=HAT2 PE=3 SV=2 174 360 1.0E-09
sp|Q4WEI5|HAT2_ASPFU Histone acetyltransferase type B subunit 2 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=hat2 PE=3 SV=1 164 360 1.0E-09
sp|O22468|MSI2_ARATH WD-40 repeat-containing protein MSI2 OS=Arabidopsis thaliana GN=MSI2 PE=2 SV=1 205 320 1.0E-09
sp|Q94AD8|FBW3_ARATH F-box/WD-40 repeat-containing protein At5g21040 OS=Arabidopsis thaliana GN=At5g21040 PE=2 SV=1 61 359 1.0E-09
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 204 363 1.0E-09
sp|Q9FLX9|NLE1_ARATH Notchless protein homolog OS=Arabidopsis thaliana GN=NLE1 PE=2 SV=1 272 378 2.0E-09
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 204 371 2.0E-09
sp|P90916|LIN53_CAEEL Probable histone-binding protein lin-53 OS=Caenorhabditis elegans GN=lin-53 PE=1 SV=2 206 360 2.0E-09
sp|C4JPW9|LIS12_UNCRE Nuclear distribution protein PAC1-2 OS=Uncinocarpus reesii (strain UAMH 1704) GN=PAC1-2 PE=3 SV=1 204 365 2.0E-09
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 64 365 2.0E-09
sp|O88879|APAF_MOUSE Apoptotic protease-activating factor 1 OS=Mus musculus GN=Apaf1 PE=1 SV=3 63 369 2.0E-09
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 206 369 2.0E-09
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 61 370 3.0E-09
sp|D5GBI7|LIS1_TUBMM Nuclear distribution protein PAC1 OS=Tuber melanosporum (strain Mel28) GN=PAC1 PE=3 SV=1 204 368 3.0E-09
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 204 376 3.0E-09
sp|Q6NV31|WDR82_DANRE WD repeat-containing protein 82 OS=Danio rerio GN=wdr82 PE=2 SV=1 206 381 3.0E-09
sp|Q9VLN1|WDR82_DROME WD repeat-containing protein 82 OS=Drosophila melanogaster GN=Wdr82 PE=1 SV=1 199 381 3.0E-09
sp|Q6CSI1|HAT2_KLULA Histone acetyltransferase type B subunit 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=HAT2 PE=3 SV=1 65 233 4.0E-09
sp|Q7T0P4|POC1A_XENLA POC1 centriolar protein homolog A OS=Xenopus laevis GN=poc1a PE=1 SV=2 63 376 4.0E-09
sp|Q2HBX6|LIS11_CHAGB Nuclear distribution protein PAC1-1 OS=Chaetomium globosum (strain ATCC 6205 / CBS 148.51 / DSM 1962 / NBRC 6347 / NRRL 1970) GN=PAC1-1 PE=3 SV=1 206 359 4.0E-09
sp|P0CS42|LIS1_CRYNJ Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=PAC1 PE=3 SV=1 206 398 4.0E-09
sp|P0CS43|LIS1_CRYNB Nuclear distribution protein PAC1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=PAC1 PE=3 SV=1 206 398 4.0E-09
sp|Q5XGI5|WDR83_XENTR WD repeat domain-containing protein 83 OS=Xenopus tropicalis GN=wdr83 PE=2 SV=1 117 359 4.0E-09
sp|Q0V8J1|WSB2_BOVIN WD repeat and SOCS box-containing protein 2 OS=Bos taurus GN=WSB2 PE=2 SV=1 82 361 5.0E-09
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 82 361 5.0E-09
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 205 367 5.0E-09
sp|Q5BJQ6|CSTF1_RAT Cleavage stimulation factor subunit 1 OS=Rattus norvegicus GN=Cstf1 PE=2 SV=1 106 398 5.0E-09
sp|Q99LC2|CSTF1_MOUSE Cleavage stimulation factor subunit 1 OS=Mus musculus GN=Cstf1 PE=1 SV=1 106 398 5.0E-09
sp|Q61Y48|LIN53_CAEBR Probable histone-binding protein lin-53 OS=Caenorhabditis briggsae GN=lin-53 PE=3 SV=2 206 360 5.0E-09
sp|Q9SY00|WDR5B_ARATH COMPASS-like H3K4 histone methylase component WDR5B OS=Arabidopsis thaliana GN=WDR5B PE=1 SV=1 158 371 6.0E-09
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 238 359 6.0E-09
sp|Q498M4|WDR5_RAT WD repeat-containing protein 5 OS=Rattus norvegicus GN=Wdr5 PE=1 SV=1 64 365 6.0E-09
sp|P61965|WDR5_MOUSE WD repeat-containing protein 5 OS=Mus musculus GN=Wdr5 PE=1 SV=1 64 365 6.0E-09
sp|P61964|WDR5_HUMAN WD repeat-containing protein 5 OS=Homo sapiens GN=WDR5 PE=1 SV=1 64 365 6.0E-09
sp|Q2KIG2|WDR5_BOVIN WD repeat-containing protein 5 OS=Bos taurus GN=WDR5 PE=2 SV=1 64 365 7.0E-09
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 224 359 7.0E-09
sp|Q9BQ67|GRWD1_HUMAN Glutamate-rich WD repeat-containing protein 1 OS=Homo sapiens GN=GRWD1 PE=1 SV=1 205 308 7.0E-09
sp|Q5M786|WDR5_XENTR WD repeat-containing protein 5 OS=Xenopus tropicalis GN=wdr5 PE=2 SV=1 64 365 8.0E-09
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 64 360 8.0E-09
sp|Q5ZMV7|WDR82_CHICK WD repeat-containing protein 82 OS=Gallus gallus GN=WDR82 PE=2 SV=1 199 381 9.0E-09
sp|B0XAF3|CIAO1_CULQU Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Culex quinquefasciatus GN=Ciao1 PE=3 SV=1 218 360 9.0E-09
sp|Q8YTC2|Y2800_NOSS1 Uncharacterized WD repeat-containing protein alr2800 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr2800 PE=3 SV=1 182 359 1.0E-08
sp|A7RWD2|CIAO1_NEMVE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Nematostella vectensis GN=v1g226592 PE=3 SV=1 64 400 1.0E-08
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 206 359 1.0E-08
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 204 358 1.0E-08
sp|Q969H0|FBXW7_HUMAN F-box/WD repeat-containing protein 7 OS=Homo sapiens GN=FBXW7 PE=1 SV=1 63 365 1.0E-08
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 82 319 1.0E-08
sp|Q75C99|HAT2_ASHGO Histone acetyltransferase type B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAT2 PE=3 SV=1 65 233 1.0E-08
sp|O13282|TAF5_SCHPO Transcription initiation factor TFIID subunit 5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf5 PE=1 SV=1 206 375 1.0E-08
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 67 316 1.0E-08
sp|Q5XI13|GRWD1_RAT Glutamate-rich WD repeat-containing protein 1 OS=Rattus norvegicus GN=Grwd1 PE=2 SV=1 205 308 1.0E-08
sp|Q54DS4|Y2056_DICDI WD repeat-containing protein DDB_G0292056 OS=Dictyostelium discoideum GN=DDB_G0292056 PE=3 SV=1 114 367 1.0E-08
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 58 371 2.0E-08
sp|P25387|GBLP_CHLRE Guanine nucleotide-binding protein subunit beta-like protein OS=Chlamydomonas reinhardtii GN=GBLP PE=2 SV=1 261 369 2.0E-08
sp|Q8N136|DAW1_HUMAN Dynein assembly factor with WDR repeat domains 1 OS=Homo sapiens GN=DAW1 PE=1 SV=1 63 365 2.0E-08
sp|O22607|MSI4_ARATH WD-40 repeat-containing protein MSI4 OS=Arabidopsis thaliana GN=MSI4 PE=1 SV=3 204 360 2.0E-08
sp|Q9JHB4|WDR31_MOUSE WD repeat-containing protein 31 OS=Mus musculus GN=Wdr31 PE=2 SV=1 200 363 2.0E-08
sp|P49178|GBB_MAIZE Guanine nucleotide-binding protein subunit beta OS=Zea mays GN=GB1 PE=2 SV=1 63 365 2.0E-08
sp|Q96JK2|DCAF5_HUMAN DDB1- and CUL4-associated factor 5 OS=Homo sapiens GN=DCAF5 PE=1 SV=2 174 363 2.0E-08
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 251 385 2.0E-08
sp|Q17N69|LIS1_AEDAE Lissencephaly-1 homolog OS=Aedes aegypti GN=AAEL000770 PE=3 SV=2 205 368 2.0E-08
sp|Q8NA23|WDR31_HUMAN WD repeat-containing protein 31 OS=Homo sapiens GN=WDR31 PE=2 SV=1 200 363 2.0E-08
sp|F1MNN4|FBXW7_BOVIN F-box/WD repeat-containing protein 7 OS=Bos taurus GN=FBXW7 PE=1 SV=2 63 365 2.0E-08
sp|Q8N9V3|WSDU1_HUMAN WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 261 363 2.0E-08
sp|Q9NVX2|NLE1_HUMAN Notchless protein homolog 1 OS=Homo sapiens GN=NLE1 PE=1 SV=4 272 376 3.0E-08
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 221 366 3.0E-08
sp|Q2UA71|HAT2_ASPOR Histone acetyltransferase type B subunit 2 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=hat2 PE=3 SV=1 124 360 3.0E-08
sp|Q5ZMC3|WSDU1_CHICK WD repeat, SAM and U-box domain-containing protein 1 OS=Gallus gallus GN=WDSUB1 PE=2 SV=2 201 362 3.0E-08
sp|Q1JQD2|GRWD1_BOVIN Glutamate-rich WD repeat-containing protein 1 OS=Bos taurus GN=GRWD1 PE=2 SV=1 205 308 3.0E-08
sp|Q640J6|WD82A_XENLA WD repeat-containing protein 82-A OS=Xenopus laevis GN=wdr82-a PE=2 SV=1 199 381 3.0E-08
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 64 360 3.0E-08
sp|Q9M2Z2|WDR5A_ARATH COMPASS-like H3K4 histone methylase component WDR5A OS=Arabidopsis thaliana GN=WDR5A PE=1 SV=1 204 365 3.0E-08
sp|P0CS32|EIF3I_CRYNJ Eukaryotic translation initiation factor 3 subunit I OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TIF34 PE=3 SV=1 234 400 3.0E-08
sp|P0CS33|EIF3I_CRYNB Eukaryotic translation initiation factor 3 subunit I OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TIF34 PE=3 SV=1 234 400 3.0E-08
sp|A1CF18|LIS12_ASPCL Nuclear distribution protein nudF 2 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-2 PE=3 SV=1 204 399 3.0E-08
sp|O00628|PEX7_HUMAN Peroxisomal targeting signal 2 receptor OS=Homo sapiens GN=PEX7 PE=1 SV=1 251 385 4.0E-08
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 219 359 4.0E-08
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 251 385 4.0E-08
sp|Q8VBV4|FBXW7_MOUSE F-box/WD repeat-containing protein 7 OS=Mus musculus GN=Fbxw7 PE=1 SV=1 63 365 4.0E-08
sp|Q6FXI8|HAT2_CANGA Histone acetyltransferase type B subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAT2 PE=3 SV=1 113 316 4.0E-08
sp|Q8SRK1|HAT2_ENCCU Histone acetyltransferase type B subunit 2 OS=Encephalitozoon cuniculi (strain GB-M1) GN=HAT2 PE=1 SV=1 164 365 4.0E-08
sp|Q80T85|DCAF5_MOUSE DDB1- and CUL4-associated factor 5 OS=Mus musculus GN=Dcaf5 PE=1 SV=2 174 363 4.0E-08
sp|Q9VPR4|NLE_DROME Protein Notchless OS=Drosophila melanogaster GN=Nle PE=1 SV=2 272 398 5.0E-08
sp|A2CEH0|POC1B_DANRE POC1 centriolar protein homolog B OS=Danio rerio GN=poc1b PE=2 SV=1 204 359 5.0E-08
sp|C4Q0P6|LIS1_SCHMA Lissencephaly-1 homolog OS=Schistosoma mansoni GN=Smp_129340 PE=3 SV=1 35 362 5.0E-08
sp|Q6S7B0|TAF5_ARATH Transcription initiation factor TFIID subunit 5 OS=Arabidopsis thaliana GN=TAF5 PE=1 SV=1 252 365 5.0E-08
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 206 365 5.0E-08
sp|Q09715|TUP11_SCHPO Transcriptional repressor tup11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tup11 PE=1 SV=1 114 378 5.0E-08
sp|Q810D6|GRWD1_MOUSE Glutamate-rich WD repeat-containing protein 1 OS=Mus musculus GN=Grwd1 PE=1 SV=2 205 308 5.0E-08
sp|Q10G81|MSI1_ORYSJ Histone-binding protein MSI1 homolog OS=Oryza sativa subsp. japonica GN=MSI1 PE=2 SV=1 174 360 5.0E-08
sp|Q58E77|WD82B_XENLA WD repeat-containing protein 82-B OS=Xenopus laevis GN=wdr82-b PE=2 SV=1 199 381 5.0E-08
sp|Q8BFQ4|WDR82_MOUSE WD repeat-containing protein 82 OS=Mus musculus GN=Wdr82 PE=1 SV=1 209 381 5.0E-08
sp|Q6UXN9|WDR82_HUMAN WD repeat-containing protein 82 OS=Homo sapiens GN=WDR82 PE=1 SV=1 209 381 5.0E-08
sp|P38129|TAF5_YEAST Transcription initiation factor TFIID subunit 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TAF5 PE=1 SV=1 205 366 6.0E-08
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 48 317 6.0E-08
sp|Q6GL39|WDR82_XENTR WD repeat-containing protein 82 OS=Xenopus tropicalis GN=wdr82 PE=2 SV=1 209 381 6.0E-08
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 219 363 6.0E-08
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 206 365 6.0E-08
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 204 365 6.0E-08
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 204 365 6.0E-08
sp|Q8VEJ4|NLE1_MOUSE Notchless protein homolog 1 OS=Mus musculus GN=Nle1 PE=1 SV=4 272 359 7.0E-08
sp|Q6P2Y2|DAW1_XENTR Dynein assembly factor with WDR repeat domains 1 OS=Xenopus tropicalis GN=daw1 PE=2 SV=1 258 418 7.0E-08
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 111 359 7.0E-08
sp|Q03897|WDR59_YEAST Maintenance of telomere capping protein 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MTC5 PE=1 SV=1 205 350 7.0E-08
sp|Q5RFF8|NLE1_PONAB Notchless protein homolog 1 OS=Pongo abelii GN=NLE1 PE=2 SV=3 272 374 8.0E-08
sp|Q5FWQ6|DAW1_XENLA Dynein assembly factor with WDR repeat domains 1 OS=Xenopus laevis GN=daw1 PE=2 SV=1 258 419 8.0E-08
sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 181 316 8.0E-08
sp|P46800|GBLP_DICDI Guanine nucleotide-binding protein subunit beta-like protein OS=Dictyostelium discoideum GN=gpbB PE=1 SV=2 251 376 8.0E-08
sp|Q9UT57|CFD1_SCHPO Probable cytosolic Fe-S cluster assembly factor SPAC806.02c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC806.02c PE=3 SV=1 205 359 8.0E-08
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 272 359 9.0E-08
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 204 365 9.0E-08
sp|P25382|NLE1_YEAST Ribosome assembly protein 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSA4 PE=1 SV=3 63 368 1.0E-07
sp|Q58D20|NLE1_BOVIN Notchless protein homolog 1 OS=Bos taurus GN=NLE1 PE=2 SV=3 272 359 1.0E-07
sp|P49695|PKWA_THECU Probable serine/threonine-protein kinase PkwA OS=Thermomonospora curvata GN=pkwA PE=3 SV=1 267 371 1.0E-07
sp|Q8NBT0|POC1A_HUMAN POC1 centriolar protein homolog A OS=Homo sapiens GN=POC1A PE=1 SV=2 64 316 1.0E-07
sp|Q75C99|HAT2_ASHGO Histone acetyltransferase type B subunit 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=HAT2 PE=3 SV=1 159 361 1.0E-07
sp|Q25189|GBLP_HYDVU Guanine nucleotide-binding protein subunit beta-like protein OS=Hydra vulgaris GN=RACK1 PE=2 SV=1 250 376 1.0E-07
sp|Q6BK34|HAT2_DEBHA Histone acetyltransferase type B subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=HAT2 PE=3 SV=1 159 360 1.0E-07
sp|Q7ZTY4|RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio GN=rbbp7 PE=2 SV=1 170 360 1.0E-07
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 217 365 1.0E-07
sp|Q9W5Z5|WSB1_TAKRU WD repeat and SOCS box-containing protein 1 OS=Takifugu rubripes GN=wsb1 PE=2 SV=1 204 371 1.0E-07
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 206 365 1.0E-07
sp|Q3SWX8|RBBP7_BOVIN Histone-binding protein RBBP7 OS=Bos taurus GN=RBBP7 PE=2 SV=1 206 360 1.0E-07
sp|Q60973|RBBP7_MOUSE Histone-binding protein RBBP7 OS=Mus musculus GN=Rbbp7 PE=1 SV=1 206 360 1.0E-07
sp|Q71UF4|RBBP7_RAT Histone-binding protein RBBP7 OS=Rattus norvegicus GN=Rbbp7 PE=2 SV=1 206 360 1.0E-07
sp|Q4R304|RBBP7_MACFA Histone-binding protein RBBP7 OS=Macaca fascicularis GN=RBBP7 PE=2 SV=1 206 360 1.0E-07
sp|Q16576|RBBP7_HUMAN Histone-binding protein RBBP7 OS=Homo sapiens GN=RBBP7 PE=1 SV=1 206 360 1.0E-07
sp|Q04727|TLE4_HUMAN Transducin-like enhancer protein 4 OS=Homo sapiens GN=TLE4 PE=1 SV=3 77 360 1.0E-07
sp|Q62441|TLE4_MOUSE Transducin-like enhancer protein 4 OS=Mus musculus GN=Tle4 PE=1 SV=4 77 360 1.0E-07
sp|P16371|GROU_DROME Protein groucho OS=Drosophila melanogaster GN=gro PE=1 SV=3 77 359 1.0E-07
sp|O54929|WSB2_MOUSE WD repeat and SOCS box-containing protein 2 OS=Mus musculus GN=Wsb2 PE=2 SV=2 82 361 2.0E-07
sp|Q8JZX3|POC1A_MOUSE POC1 centriolar protein homolog A OS=Mus musculus GN=Poc1a PE=2 SV=2 64 316 2.0E-07
sp|Q7ZVF0|POC1A_DANRE POC1 centriolar protein homolog A OS=Danio rerio GN=poc1a PE=2 SV=1 63 362 2.0E-07
sp|Q9NYS7|WSB2_HUMAN WD repeat and SOCS box-containing protein 2 OS=Homo sapiens GN=WSB2 PE=2 SV=1 214 398 2.0E-07
sp|Q8N9V3|WSDU1_HUMAN WD repeat, SAM and U-box domain-containing protein 1 OS=Homo sapiens GN=WDSUB1 PE=1 SV=3 201 362 2.0E-07
sp|C1GB49|LIS1_PARBD Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb18) GN=PAC1 PE=3 SV=1 205 364 2.0E-07
sp|Q6INH0|RBP4B_XENLA Histone-binding protein RBBP4-B OS=Xenopus laevis GN=rbbp4-b PE=1 SV=3 170 360 2.0E-07
sp|O42478|TLE4_XENLA Transducin-like enhancer protein 4 OS=Xenopus laevis GN=tle4 PE=1 SV=2 77 360 2.0E-07
sp|Q5M7K4|RBBP4_XENTR Histone-binding protein RBBP4 OS=Xenopus tropicalis GN=rbbp4 PE=2 SV=3 170 360 2.0E-07
sp|O93377|RBP4A_XENLA Histone-binding protein RBBP4-A OS=Xenopus laevis GN=rbbp4-a PE=1 SV=3 170 360 2.0E-07
sp|O42249|GBLP_ORENI Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Oreochromis niloticus GN=gnb2l1 PE=2 SV=1 250 376 2.0E-07
sp|O42248|GBLP_DANRE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Danio rerio GN=gnb2l1 PE=2 SV=1 250 376 2.0E-07
sp|A8XZJ9|LIS1_CAEBR Lissencephaly-1 homolog OS=Caenorhabditis briggsae GN=lis-1 PE=3 SV=2 206 367 2.0E-07
sp|D4DG66|LIS1_TRIVH Nuclear distribution protein PAC1 OS=Trichophyton verrucosum (strain HKI 0517) GN=PAC1 PE=3 SV=1 204 365 2.0E-07
sp|D4AZ50|LIS1_ARTBC Nuclear distribution protein PAC1 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=PAC1 PE=3 SV=1 204 365 2.0E-07
sp|A0AUS0|WSDU1_DANRE WD repeat, SAM and U-box domain-containing protein 1 OS=Danio rerio GN=wdsub1 PE=2 SV=1 261 359 2.0E-07
sp|Q9NDC9|LIS1_CAEEL Lissencephaly-1 homolog OS=Caenorhabditis elegans GN=lis-1 PE=2 SV=1 194 393 2.0E-07
sp|Q17GR9|CIAO1_AEDAE Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Aedes aegypti GN=Ciao1 PE=3 SV=1 217 360 2.0E-07
sp|Q5RF92|RBBP4_PONAB Histone-binding protein RBBP4 OS=Pongo abelii GN=RBBP4 PE=2 SV=3 174 360 2.0E-07
sp|P63245|GBLP_RAT Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Rattus norvegicus GN=Gnb2l1 PE=1 SV=3 250 376 2.0E-07
sp|P63246|GBLP_PIG Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Sus scrofa GN=GNB2L1 PE=1 SV=3 250 376 2.0E-07
sp|P68040|GBLP_MOUSE Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Mus musculus GN=Gnb2l1 PE=1 SV=3 250 376 2.0E-07
sp|Q4R7Y4|GBLP_MACFA Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Macaca fascicularis GN=GNB2L1 PE=2 SV=3 250 376 2.0E-07
sp|P63244|GBLP_HUMAN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Homo sapiens GN=GNB2L1 PE=1 SV=3 250 376 2.0E-07
sp|P63247|GBLP_CHICK Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Gallus gallus GN=GNB2L1 PE=2 SV=1 250 376 2.0E-07
sp|P63243|GBLP_BOVIN Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Bos taurus GN=GNB2L1 PE=2 SV=3 250 376 2.0E-07
sp|B4J8H6|WDR48_DROGR WD repeat-containing protein 48 homolog OS=Drosophila grimshawi GN=GH21936 PE=3 SV=1 63 356 2.0E-07
sp|O14021|PRW1_SCHPO RbAp48-related WD40 repeat-containing protein prw1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=prw1 PE=1 SV=1 175 320 2.0E-07
sp|B6GZD3|LIS12_PENRW Nuclear distribution protein nudF 2 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-2 PE=3 SV=1 204 365 2.0E-07
sp|Q9W7I5|RBBP4_CHICK Histone-binding protein RBBP4 OS=Gallus gallus GN=RBBP4 PE=1 SV=3 174 360 2.0E-07
sp|P54686|AIP1_DICDI Actin-interacting protein 1 OS=Dictyostelium discoideum GN=aip1 PE=1 SV=2 230 370 2.0E-07
sp|Q4I7L0|HAT2_GIBZE Histone acetyltransferase type B subunit 2 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=HAT2 PE=3 SV=1 206 364 2.0E-07
sp|Q60972|RBBP4_MOUSE Histone-binding protein RBBP4 OS=Mus musculus GN=Rbbp4 PE=1 SV=5 174 360 2.0E-07
sp|Q09028|RBBP4_HUMAN Histone-binding protein RBBP4 OS=Homo sapiens GN=RBBP4 PE=1 SV=3 174 360 2.0E-07
sp|Q3MHL3|RBBP4_BOVIN Histone-binding protein RBBP4 OS=Bos taurus GN=RBBP4 PE=1 SV=3 174 360 2.0E-07
sp|C5FWH1|LIS1_ARTOC Nuclear distribution protein PAC1 OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=PAC1 PE=3 SV=1 204 365 2.0E-07
sp|Q6FXI8|HAT2_CANGA Histone acetyltransferase type B subunit 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=HAT2 PE=3 SV=1 65 234 3.0E-07
sp|P16649|TUP1_YEAST General transcriptional corepressor TUP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUP1 PE=1 SV=2 251 363 3.0E-07
sp|C0S902|LIS1_PARBP Nuclear distribution protein PAC1 OS=Paracoccidioides brasiliensis (strain Pb03) GN=PAC1 PE=3 SV=2 205 364 3.0E-07
sp|Q8C092|TAF5_MOUSE Transcription initiation factor TFIID subunit 5 OS=Mus musculus GN=Taf5 PE=1 SV=1 261 359 3.0E-07
sp|P69104|GBLP_TRYBR Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei rhodesiense PE=2 SV=1 285 374 3.0E-07
sp|P69103|GBLP_TRYBB Guanine nucleotide-binding protein subunit beta-like protein OS=Trypanosoma brucei brucei PE=2 SV=1 285 374 3.0E-07
sp|Q40687|GBB_ORYSJ Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. japonica GN=RGB1 PE=1 SV=1 63 365 3.0E-07
sp|B8AP31|GBB_ORYSI Guanine nucleotide-binding protein subunit beta OS=Oryza sativa subsp. indica GN=RGBB PE=2 SV=1 63 365 3.0E-07
sp|Q10281|GBLP_SCHPO Guanine nucleotide-binding protein subunit beta-like protein OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rkp1 PE=1 SV=3 261 374 3.0E-07
sp|B3MHX6|BOP1_DROAN Ribosome biogenesis protein BOP1 homolog OS=Drosophila ananassae GN=GF11675 PE=3 SV=1 63 356 3.0E-07
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 204 359 3.0E-07
sp|Q29HG9|LST8_DROPS Protein LST8 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA15597 PE=3 SV=1 174 360 3.0E-07
sp|Q9R1A8|RFWD2_MOUSE E3 ubiquitin-protein ligase RFWD2 OS=Mus musculus GN=Rfwd2 PE=1 SV=2 115 359 3.0E-07
sp|Q6P3H7|RBBP4_DANRE Histone-binding protein RBBP4 OS=Danio rerio GN=rbbp4 PE=2 SV=3 174 360 3.0E-07
sp|Q93134|GBLP_BIOGL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Biomphalaria glabrata PE=2 SV=1 249 374 3.0E-07
sp|B2B766|LIS12_PODAN Nuclear distribution protein PAC1-2 OS=Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) GN=PAC1-2 PE=3 SV=1 206 404 3.0E-07
sp|Q8NHY2|RFWD2_HUMAN E3 ubiquitin-protein ligase RFWD2 OS=Homo sapiens GN=RFWD2 PE=1 SV=1 209 359 4.0E-07
sp|P78972|SLP1_SCHPO WD repeat-containing protein slp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=slp1 PE=1 SV=1 117 360 4.0E-07
sp|Q5DFU0|CIAO1_SCHJA Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Schistosoma japonicum PE=2 SV=1 119 369 4.0E-07
sp|Q15542|TAF5_HUMAN Transcription initiation factor TFIID subunit 5 OS=Homo sapiens GN=TAF5 PE=1 SV=3 261 359 4.0E-07
sp|O61585|KTNB1_STRPU Katanin p80 WD40 repeat-containing subunit B1 OS=Strongylocentrotus purpuratus GN=KATNB1 PE=1 SV=1 157 359 4.0E-07
sp|Q6NLV4|FY_ARATH Flowering time control protein FY OS=Arabidopsis thaliana GN=FY PE=1 SV=1 204 359 4.0E-07
sp|O59894|PEX7_PICPA Peroxisomal targeting signal 2 receptor OS=Komagataella pastoris GN=PEX7 PE=3 SV=1 49 317 4.0E-07
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 249 421 4.0E-07
sp|Q7T2F6|WSB1_DANRE WD repeat and SOCS box-containing protein 1 OS=Danio rerio GN=wsb1 PE=2 SV=1 204 369 4.0E-07
sp|P41318|LST8_YEAST Target of rapamycin complex subunit LST8 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LST8 PE=1 SV=1 82 378 4.0E-07
sp|C3XVT5|LIS1_BRAFL Lissencephaly-1 homolog OS=Branchiostoma floridae GN=BRAFLDRAFT_59218 PE=3 SV=1 206 368 4.0E-07
sp|Q62440|TLE1_MOUSE Transducin-like enhancer protein 1 OS=Mus musculus GN=Tle1 PE=1 SV=2 77 360 4.0E-07
sp|Q8TEQ6|GEMI5_HUMAN Gem-associated protein 5 OS=Homo sapiens GN=GEMIN5 PE=1 SV=3 70 367 4.0E-07
sp|Q9VU65|POC1_DROME POC1 centriolar protein homolog OS=Drosophila melanogaster GN=Poc1 PE=2 SV=1 206 365 5.0E-07
sp|P49846|TAF5_DROME Transcription initiation factor TFIID subunit 5 OS=Drosophila melanogaster GN=Taf5 PE=1 SV=1 209 359 5.0E-07
sp|O35828|CORO7_RAT Coronin-7 OS=Rattus norvegicus GN=Coro7 PE=1 SV=2 64 266 5.0E-07
sp|Q7S7L4|LIS12_NEUCR Nuclear distribution protein nudF-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=nmp-2 PE=3 SV=2 206 359 5.0E-07
sp|Q07141|TLE4_RAT Transducin-like enhancer protein 4 OS=Rattus norvegicus GN=Tle4 PE=1 SV=2 77 359 5.0E-07
sp|Q04724|TLE1_HUMAN Transducin-like enhancer protein 1 OS=Homo sapiens GN=TLE1 PE=1 SV=2 77 360 5.0E-07
sp|A0CH87|LIS12_PARTE Lissencephaly-1 homolog 2 OS=Paramecium tetraurelia GN=GSPATT00007594001 PE=3 SV=1 206 393 5.0E-07
sp|Q55563|Y163_SYNY3 Uncharacterized WD repeat-containing protein sll0163 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=sll0163 PE=3 SV=1 63 365 6.0E-07
sp|Q2TBP4|POC1A_BOVIN POC1 centriolar protein homolog A OS=Bos taurus GN=POC1A PE=2 SV=1 64 362 6.0E-07
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 221 363 6.0E-07
sp|Q229Z6|POC1_TETTS POC1 centriolar protein homolog OS=Tetrahymena thermophila (strain SB210) GN=TTHERM_01308010 PE=3 SV=1 261 362 6.0E-07
sp|Q28YY2|WDR48_DROPS WD repeat-containing protein 48 homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA21511 PE=3 SV=2 63 356 6.0E-07
sp|B4GIJ0|WDR48_DROPE WD repeat-containing protein 48 homolog OS=Drosophila persimilis GN=GL16745 PE=3 SV=1 63 356 6.0E-07
sp|Q9JIT3|TLE3_RAT Transducin-like enhancer protein 3 OS=Rattus norvegicus GN=Tle3 PE=1 SV=1 77 360 6.0E-07
sp|Q9Y263|PLAP_HUMAN Phospholipase A-2-activating protein OS=Homo sapiens GN=PLAA PE=1 SV=2 261 367 6.0E-07
sp|Q08122|TLE3_MOUSE Transducin-like enhancer protein 3 OS=Mus musculus GN=Tle3 PE=1 SV=3 77 360 7.0E-07
sp|Q0V8F1|CORO7_BOVIN Coronin-7 OS=Bos taurus GN=CORO7 PE=2 SV=1 64 266 7.0E-07
sp|Q04726|TLE3_HUMAN Transducin-like enhancer protein 3 OS=Homo sapiens GN=TLE3 PE=1 SV=2 77 360 7.0E-07
sp|Q3KQ62|WDR83_XENLA WD repeat domain-containing protein 83 OS=Xenopus laevis GN=wdr83 PE=2 SV=1 112 359 7.0E-07
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 55 353 7.0E-07
sp|O17468|HIRA_DROME Protein HIRA homolog OS=Drosophila melanogaster GN=Hira PE=1 SV=2 251 349 7.0E-07
sp|Q7ZXK9|NLE1_XENLA Notchless protein homolog 1 OS=Xenopus laevis GN=nle1 PE=2 SV=1 63 360 8.0E-07
sp|Q9D994|WDR38_MOUSE WD repeat-containing protein 38 OS=Mus musculus GN=Wdr38 PE=2 SV=1 261 364 8.0E-07
sp|C5JD40|LIS1_AJEDS Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain SLH14081) GN=PAC1 PE=3 SV=1 205 364 8.0E-07
sp|C5GVJ9|LIS1_AJEDR Nuclear distribution protein PAC1 OS=Ajellomyces dermatitidis (strain ER-3 / ATCC MYA-2586) GN=PAC1 PE=3 SV=1 205 364 8.0E-07
sp|Q4V837|DTLA_XENLA Denticleless protein homolog A OS=Xenopus laevis GN=dtl-a PE=2 SV=1 65 364 8.0E-07
sp|D1ZEM6|LIS12_SORMK Nuclear distribution protein PAC1-2 OS=Sordaria macrospora (strain ATCC MYA-333 / DSM 997 / K(L3346) / K-hell) GN=PAC1-2 PE=3 SV=1 206 359 8.0E-07
sp|Q4WLM7|LIS1_ASPFU Nuclear distribution protein nudF OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=nudF PE=3 SV=1 206 365 8.0E-07
sp|B0XM00|LIS1_ASPFC Nuclear distribution protein nudF OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=nudF PE=3 SV=1 206 365 8.0E-07
sp|Q5RBW3|CORO7_PONAB Coronin-7 OS=Pongo abelii GN=CORO7 PE=2 SV=1 214 364 8.0E-07
sp|Q5REG7|LIS1_PONAB Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pongo abelii GN=PAFAH1B1 PE=2 SV=3 206 368 8.0E-07
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 261 363 9.0E-07
sp|Q9I8G9|RBBP7_CHICK Histone-binding protein RBBP7 OS=Gallus gallus GN=RBBP7 PE=1 SV=1 206 360 9.0E-07
sp|B2VWG7|LIS1_PYRTR Nuclear distribution protein PAC1 OS=Pyrenophora tritici-repentis (strain Pt-1C-BFP) GN=pac1 PE=3 SV=1 206 365 9.0E-07
sp|P27612|PLAP_MOUSE Phospholipase A-2-activating protein OS=Mus musculus GN=Plaa PE=1 SV=4 261 369 9.0E-07
sp|O43017|SWD3_SCHPO Set1 complex component swd3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=swd3 PE=1 SV=1 249 359 9.0E-07
sp|Q6BVZ3|PFS2_DEBHA Polyadenylation factor subunit 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=PFS2 PE=3 SV=2 63 320 9.0E-07
sp|Q8YRI1|YY46_NOSS1 Uncharacterized WD repeat-containing protein alr3466 OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=alr3466 PE=3 SV=1 261 365 1.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 205 359 1.0E-06
sp|P78706|RCO1_NEUCR Transcriptional repressor rco-1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=rco-1 PE=3 SV=2 82 359 1.0E-06
sp|Q8R537|PEX7_CRIGR Peroxisomal targeting signal 2 receptor OS=Cricetulus griseus GN=PEX7 PE=1 SV=1 67 316 1.0E-06
sp|P93107|PF20_CHLRE Flagellar WD repeat-containing protein Pf20 OS=Chlamydomonas reinhardtii GN=PF20 PE=2 SV=1 204 374 1.0E-06
sp|Q6ZMY6|WDR88_HUMAN WD repeat-containing protein 88 OS=Homo sapiens GN=WDR88 PE=2 SV=2 205 359 1.0E-06
sp|Q09855|POF11_SCHPO F-box/WD repeat-containing protein pof11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pof11 PE=1 SV=2 63 359 1.0E-06
sp|Q5JTN6|WDR38_HUMAN WD repeat-containing protein 38 OS=Homo sapiens GN=WDR38 PE=2 SV=1 261 390 1.0E-06
sp|Q54PE0|PWP2_DICDI Periodic tryptophan protein 2 homolog OS=Dictyostelium discoideum GN=pwp2 PE=3 SV=1 206 361 1.0E-06
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 261 359 1.0E-06
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 55 353 1.0E-06
sp|Q6PE01|SNR40_MOUSE U5 small nuclear ribonucleoprotein 40 kDa protein OS=Mus musculus GN=Snrnp40 PE=1 SV=1 261 382 1.0E-06
sp|P57737|CORO7_HUMAN Coronin-7 OS=Homo sapiens GN=CORO7 PE=1 SV=2 214 364 1.0E-06
sp|Q8AVH1|RBBP7_XENLA Histone-binding protein RBBP7 OS=Xenopus laevis GN=rbbp7 PE=2 SV=1 206 360 1.0E-06
sp|O42469|TLE1_XENLA Transducin-like enhancer protein 1 OS=Xenopus laevis GN=esg1 PE=2 SV=1 77 360 1.0E-06
sp|P54319|PLAP_RAT Phospholipase A-2-activating protein OS=Rattus norvegicus GN=Plaa PE=1 SV=3 261 367 1.0E-06
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 261 382 1.0E-06
sp|Q96DI7|SNR40_HUMAN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Homo sapiens GN=SNRNP40 PE=1 SV=1 55 353 1.0E-06
sp|Q6P315|RBBP7_XENTR Histone-binding protein RBBP7 OS=Xenopus tropicalis GN=rbbp7 PE=2 SV=1 206 360 1.0E-06
sp|Q6P1V3|WSB1_XENTR WD repeat and SOCS box-containing protein 1 OS=Xenopus tropicalis GN=wsb1 PE=2 SV=1 206 364 1.0E-06
sp|A0DB19|LIS11_PARTE Lissencephaly-1 homolog 1 OS=Paramecium tetraurelia GN=GSPATT00015130001 PE=3 SV=1 206 393 1.0E-06
sp|Q9UI46|DNAI1_HUMAN Dynein intermediate chain 1, axonemal OS=Homo sapiens GN=DNAI1 PE=1 SV=1 64 275 1.0E-06
sp|Q21215|GBLP_CAEEL Guanine nucleotide-binding protein subunit beta-2-like 1 OS=Caenorhabditis elegans GN=rack-1 PE=1 SV=3 261 374 1.0E-06
sp|O15736|TIPD_DICDI Protein tipD OS=Dictyostelium discoideum GN=tipD PE=3 SV=1 111 377 1.0E-06
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 209 360 1.0E-06
sp|Q4R8E7|DAW1_MACFA Dynein assembly factor with WDR repeat domains 1 OS=Macaca fascicularis GN=DAW1 PE=2 SV=1 63 365 1.0E-06
sp|A4R3M4|LIS1_MAGO7 Nuclear distribution protein PAC1 OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=PAC1 PE=3 SV=3 204 359 1.0E-06
sp|Q24572|CAF1_DROME Probable histone-binding protein Caf1 OS=Drosophila melanogaster GN=Caf1 PE=1 SV=1 201 360 1.0E-06
sp|A8NEG8|LIS1_COPC7 Nuclear distribution protein PAC1 OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=PAC1 PE=3 SV=3 82 321 1.0E-06
sp|Q6FQU6|SC132_CANGA Protein transport protein SEC13-2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=SEC132 PE=3 SV=1 112 360 1.0E-06
sp|Q0U1B1|LIS1_PHANO Nuclear distribution protein PAC1 OS=Phaeosphaeria nodorum (strain SN15 / ATCC MYA-4574 / FGSC 10173) GN=PAC1 PE=3 SV=1 206 365 1.0E-06
sp|O43172|PRP4_HUMAN U4/U6 small nuclear ribonucleoprotein Prp4 OS=Homo sapiens GN=PRPF4 PE=1 SV=2 209 359 1.0E-06
sp|A1CUD6|LIS11_ASPCL Nuclear distribution protein nudF 1 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=nudF-1 PE=3 SV=1 206 365 1.0E-06
sp|Q5FVB6|WDR4_XENTR tRNA (guanine-N(7)-)-methyltransferase non-catalytic subunit wdr4 OS=Xenopus tropicalis GN=wdr4 PE=2 SV=2 187 359 1.0E-06
sp|Q9C4Z6|GPLPB_ARATH Receptor for activated C kinase 1B OS=Arabidopsis thaliana GN=RACK1B PE=1 SV=1 261 425 1.0E-06
sp|Q99LL5|PWP1_MOUSE Periodic tryptophan protein 1 homolog OS=Mus musculus GN=Pwp1 PE=1 SV=1 175 359 1.0E-06
sp|P97865|PEX7_MOUSE Peroxisomal targeting signal 2 receptor OS=Mus musculus GN=Pex7 PE=1 SV=1 67 316 2.0E-06
sp|O74855|NLE1_SCHPO Ribosome assembly protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC18.05c PE=3 SV=1 64 365 2.0E-06
sp|Q2HJH6|SNR40_BOVIN U5 small nuclear ribonucleoprotein 40 kDa protein OS=Bos taurus GN=SNRNP40 PE=2 SV=1 261 382 2.0E-06
sp|B4KRQ4|WDR48_DROMO WD repeat-containing protein 48 homolog OS=Drosophila mojavensis GN=GI19644 PE=3 SV=1 63 356 2.0E-06
sp|Q6BRR2|SEC31_DEBHA Protein transport protein SEC31 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=SEC31 PE=3 SV=2 61 329 2.0E-06
sp|Q6BSL7|EIF3I_DEBHA Eukaryotic translation initiation factor 3 subunit I OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TIF34 PE=3 SV=1 58 338 2.0E-06
sp|Q86VZ2|WDR5B_HUMAN WD repeat-containing protein 5B OS=Homo sapiens GN=WDR5B PE=2 SV=1 64 365 2.0E-06
sp|A1DP19|LIS1_NEOFI Nuclear distribution protein nudF OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=nudF PE=3 SV=1 206 365 2.0E-06
sp|Q19124|A16L1_CAEEL Autophagic-related protein 16.1 OS=Caenorhabditis elegans GN=atg-16.1 PE=3 SV=1 55 360 2.0E-06
sp|Q17963|WDR51_CAEEL WD repeat-containing protein wdr-5.1 OS=Caenorhabditis elegans GN=wdr-5.1 PE=1 SV=1 209 365 2.0E-06
sp|Q5RF51|SNR40_PONAB U5 small nuclear ribonucleoprotein 40 kDa protein OS=Pongo abelii GN=SNRNP40 PE=2 SV=1 111 359 2.0E-06
sp|Q99KN2|CIAO1_MOUSE Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Mus musculus GN=Ciao1 PE=1 SV=1 120 360 2.0E-06
sp|Q8I0F4|LIS1_DICDI Lissencephaly-1 homolog OS=Dictyostelium discoideum GN=lis1 PE=1 SV=1 204 365 2.0E-06
sp|B4MFM2|WDR48_DROVI WD repeat-containing protein 48 homolog OS=Drosophila virilis GN=GJ15009 PE=3 SV=1 63 356 2.0E-06
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 69 231 2.0E-06
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 253 378 2.0E-06
sp|P42841|PFS2_YEAST Polyadenylation factor subunit 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PFS2 PE=1 SV=1 57 327 2.0E-06
sp|B4P7Q3|CIAO1_DROYA Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila yakuba GN=Ciao1 PE=3 SV=1 206 361 2.0E-06
sp|O54927|WSB1_MOUSE WD repeat and SOCS box-containing protein 1 OS=Mus musculus GN=Wsb1 PE=1 SV=1 203 360 2.0E-06
sp|C5PFX0|LIS1_COCP7 Nuclear distribution protein PAC1 OS=Coccidioides posadasii (strain C735) GN=PAC1 PE=3 SV=2 206 365 2.0E-06
sp|Q7QJ33|WDR12_ANOGA Ribosome biogenesis protein WDR12 homolog OS=Anopheles gambiae GN=AGAP007244 PE=3 SV=3 214 362 2.0E-06
sp|Q5RE95|WDR5B_PONAB WD repeat-containing protein 5B OS=Pongo abelii PE=2 SV=1 64 365 2.0E-06
sp|Q9LV28|GPLPC_ARATH Receptor for activated C kinase 1C OS=Arabidopsis thaliana GN=RACK1C PE=1 SV=1 261 369 2.0E-06
sp|A1CGS0|SEC13_ASPCL Protein transport protein sec13 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=sec13 PE=3 SV=1 81 360 2.0E-06
sp|Q8TC44|POC1B_HUMAN POC1 centriolar protein homolog B OS=Homo sapiens GN=POC1B PE=1 SV=1 285 368 3.0E-06
sp|Q8W1K8|MUT11_CHLRE Protein Mut11 OS=Chlamydomonas reinhardtii GN=Mut11 PE=2 SV=1 280 362 3.0E-06
sp|A7S338|LIS1_NEMVE Lissencephaly-1 homolog OS=Nematostella vectensis GN=v1g242515 PE=3 SV=1 82 362 3.0E-06
sp|Q9UTC7|YIDC_SCHPO Uncharacterized WD repeat-containing protein C227.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC227.12 PE=3 SV=1 49 359 3.0E-06
sp|P73594|Y1409_SYNY3 Uncharacterized WD repeat-containing protein slr1409 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1409 PE=3 SV=1 205 360 3.0E-06
sp|B3NQR5|CIAO1_DROER Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila erecta GN=Ciao1 PE=3 SV=1 206 361 3.0E-06
sp|B6HP56|LIS11_PENRW Nuclear distribution protein nudF 1 OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=nudF-1 PE=3 SV=1 206 359 3.0E-06
sp|D3BUN1|LIS1_POLPA Lissencephaly-1 homolog OS=Polysphondylium pallidum PE=3 SV=1 204 365 3.0E-06
sp|Q9D2V7|CORO7_MOUSE Coronin-7 OS=Mus musculus GN=Coro7 PE=1 SV=2 64 266 3.0E-06
sp|Q94BM7|SPA4_ARATH Protein SPA1-RELATED 4 OS=Arabidopsis thaliana GN=SPA4 PE=1 SV=1 115 316 3.0E-06
sp|P14197|AAC3_DICDI WD repeat-containing protein AAC3 OS=Dictyostelium discoideum GN=AAC3 PE=2 SV=2 195 396 3.0E-06
sp|Q54YD8|COPB2_DICDI Coatomer subunit beta' OS=Dictyostelium discoideum GN=copb2 PE=3 SV=1 251 361 3.0E-06
sp|P0CS35|ERB1_CRYNB Ribosome biogenesis protein ERB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=ERB1 PE=3 SV=1 82 359 3.0E-06
sp|P0CS36|HAT2_CRYNJ Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=HAT2 PE=3 SV=1 206 379 3.0E-06
sp|P0CS37|HAT2_CRYNB Histone acetyltransferase type B subunit 2 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=HAT2 PE=3 SV=1 206 379 3.0E-06
sp|B4JW81|CIAO1_DROGR Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila grimshawi GN=Ciao1 PE=3 SV=1 206 358 3.0E-06
sp|P0CS34|ERB1_CRYNJ Ribosome biogenesis protein ERB1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=ERB1 PE=3 SV=1 82 359 3.0E-06
sp|Q873A1|SEC31_NEUCR Protein transport protein sec31 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=sec31 PE=3 SV=1 175 366 3.0E-06
sp|Q5AEF2|SEC13_CANAL Protein transport protein SEC13 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=SEC13 PE=1 SV=2 112 360 3.0E-06
sp|Q5RD06|POC1B_PONAB POC1 centriolar protein homolog B OS=Pongo abelii GN=POC1B PE=2 SV=1 285 368 4.0E-06
sp|Q5M7T1|CIAO1_RAT Probable cytosolic iron-sulfur protein assembly protein CIAO1 OS=Rattus norvegicus GN=Ciao1 PE=2 SV=1 120 316 4.0E-06
sp|Q9D2V7|CORO7_MOUSE Coronin-7 OS=Mus musculus GN=Coro7 PE=1 SV=2 214 364 4.0E-06
sp|Q9USR0|CKN1_SCHPO DNA excision repair protein ckn1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ckn1 PE=1 SV=1 206 367 4.0E-06
sp|Q4P9P9|LIS1_USTMA Nuclear distribution protein PAC1 OS=Ustilago maydis (strain 521 / FGSC 9021) GN=PAC1 PE=3 SV=1 206 365 4.0E-06
sp|Q7ZUV2|KTNB1_DANRE Katanin p80 WD40 repeat-containing subunit B1 OS=Danio rerio GN=katnb1 PE=2 SV=1 255 359 4.0E-06
sp|O18640|GBLP_DROME Guanine nucleotide-binding protein subunit beta-like protein OS=Drosophila melanogaster GN=Rack1 PE=1 SV=2 250 374 4.0E-06
sp|B3MET8|WDR48_DROAN WD repeat-containing protein 48 homolog OS=Drosophila ananassae GN=GF12420 PE=3 SV=1 63 356 4.0E-06
sp|Q28DW0|CIAO1_XENTR Probable cytosolic iron-sulfur protein assembly protein ciao1 OS=Xenopus tropicalis GN=ciao1 PE=2 SV=1 187 360 4.0E-06
sp|Q9VU68|WDR1_DROME Actin-interacting protein 1 OS=Drosophila melanogaster GN=flr PE=2 SV=1 206 365 4.0E-06
sp|Q2HJ56|PWP1_BOVIN Periodic tryptophan protein 1 homolog OS=Bos taurus GN=PWP1 PE=2 SV=1 203 359 4.0E-06
sp|Q54ED4|GRWD1_DICDI Glutamate-rich WD repeat-containing protein 1 OS=Dictyostelium discoideum GN=grwd1 PE=3 SV=1 215 363 5.0E-06
sp|Q54WA3|PEX7_DICDI Peroxisomal targeting signal 2 receptor OS=Dictyostelium discoideum GN=pex7 PE=3 SV=1 67 320 5.0E-06
sp|Q01369|GBLP_NEUCR Guanine nucleotide-binding protein subunit beta-like protein OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=cpc-2 PE=3 SV=1 261 376 5.0E-06
sp|B4KTK4|CIAO1_DROMO Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila mojavensis GN=Ciao1 PE=3 SV=1 206 361 5.0E-06
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 172 374 5.0E-06
sp|Q13610|PWP1_HUMAN Periodic tryptophan protein 1 homolog OS=Homo sapiens GN=PWP1 PE=1 SV=1 203 359 5.0E-06
sp|B5X3Z6|LIS1A_SALSA Lissencephaly-1 homolog A OS=Salmo salar GN=pafah1b1-1 PE=2 SV=1 206 368 5.0E-06
sp|Q9Y6I7|WSB1_HUMAN WD repeat and SOCS box-containing protein 1 OS=Homo sapiens GN=WSB1 PE=1 SV=1 206 360 5.0E-06
sp|P74442|Y143_SYNY3 Uncharacterized WD repeat-containing protein slr0143 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0143 PE=3 SV=1 64 317 6.0E-06
sp|B7QKS1|CIAO1_IXOSC Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Ixodes scapularis GN=ISCW023049 PE=3 SV=1 82 319 6.0E-06
sp|O22212|PRP4L_ARATH U4/U6 small nuclear ribonucleoprotein PRP4-like protein OS=Arabidopsis thaliana GN=EMB2776 PE=2 SV=1 82 317 6.0E-06
sp|Q26544|WSL17_SCHMA WD repeat-containing protein SL1-17 OS=Schistosoma mansoni PE=2 SV=1 251 361 6.0E-06
sp|B4LJT7|CIAO1_DROVI Probable cytosolic iron-sulfur protein assembly protein Ciao1 OS=Drosophila virilis GN=Ciao1 PE=3 SV=1 206 361 6.0E-06
sp|Q9BRX9|WDR83_HUMAN WD repeat domain-containing protein 83 OS=Homo sapiens GN=WDR83 PE=1 SV=1 117 359 6.0E-06
sp|Q0CHM0|SEC13_ASPTN Protein transport protein sec13 OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=sec13 PE=3 SV=1 52 360 6.0E-06
sp|Q7ZTY4|RBBP7_DANRE Histone-binding protein RBBP7 OS=Danio rerio GN=rbbp7 PE=2 SV=1 63 275 7.0E-06
sp|O74319|TAF73_SCHPO Transcription initiation factor TFIID subunit taf73 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=taf73 PE=1 SV=1 209 366 7.0E-06
sp|Q9PTR5|LIS1_CHICK Lissencephaly-1 homolog OS=Gallus gallus GN=PAFAH1B1 PE=2 SV=3 206 368 7.0E-06
sp|Q5U2W5|TBL3_RAT Transducin beta-like protein 3 OS=Rattus norvegicus GN=Tbl3 PE=2 SV=1 249 365 7.0E-06
sp|Q8RXA7|SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana GN=SCD1 PE=1 SV=1 69 326 7.0E-06
sp|A7TLU2|CIAO1_VANPO Probable cytosolic iron-sulfur protein assembly protein 1 OS=Vanderwaltozyma polyspora (strain ATCC 22028 / DSM 70294) GN=CIA1 PE=3 SV=1 251 365 7.0E-06
sp|B3NSK1|WDR48_DROER WD repeat-containing protein 48 homolog OS=Drosophila erecta GN=GG22678 PE=3 SV=1 63 356 7.0E-06
sp|O24456|GBLPA_ARATH Receptor for activated C kinase 1A OS=Arabidopsis thaliana GN=RACK1A PE=1 SV=2 261 369 7.0E-06
sp|C6HTE8|LIS1_AJECH Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain H143) GN=PAC1 PE=3 SV=1 204 379 7.0E-06
sp|C0NRC6|LIS1_AJECG Nuclear distribution protein PAC1 OS=Ajellomyces capsulatus (strain G186AR / H82 / ATCC MYA-2454 / RMSCC 2432) GN=PAC1 PE=3 SV=1 204 379 7.0E-06
sp|Q9V3J8|WDS_DROME Protein will die slowly OS=Drosophila melanogaster GN=wds PE=1 SV=1 285 360 8.0E-06
sp|P43034|LIS1_HUMAN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Homo sapiens GN=PAFAH1B1 PE=1 SV=2 206 368 8.0E-06
sp|Q90ZL4|LIS1_XENLA Lissencephaly-1 homolog OS=Xenopus laevis GN=pafah1b1 PE=2 SV=3 206 368 8.0E-06
sp|P63004|LIS1_RAT Platelet-activating factor acetylhydrolase IB subunit alpha OS=Rattus norvegicus GN=Pafah1b1 PE=1 SV=2 206 368 8.0E-06
sp|P63005|LIS1_MOUSE Platelet-activating factor acetylhydrolase IB subunit alpha OS=Mus musculus GN=Pafah1b1 PE=1 SV=2 206 368 8.0E-06
sp|B0LSW3|LIS1_FELCA Platelet-activating factor acetylhydrolase IB subunit alpha OS=Felis catus GN=PAFAH1B1 PE=2 SV=1 206 368 8.0E-06
sp|Q9W328|LST8_DROME Protein LST8 homolog OS=Drosophila melanogaster GN=Lst8 PE=2 SV=2 174 360 8.0E-06
sp|P43033|LIS1_BOVIN Platelet-activating factor acetylhydrolase IB subunit alpha OS=Bos taurus GN=PAFAH1B1 PE=1 SV=2 206 368 8.0E-06
sp|B5DG67|WDR12_SALSA Ribosome biogenesis protein wdr12 OS=Salmo salar GN=wdr12 PE=2 SV=1 214 368 8.0E-06
sp|Q5IS43|LIS1_PANTR Platelet-activating factor acetylhydrolase IB subunit alpha OS=Pan troglodytes GN=PAFAH1B1 PE=2 SV=3 206 368 8.0E-06
sp|Q9UT85|YIPC_SCHPO Uncharacterized WD repeat-containing protein C343.04c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC343.04c PE=3 SV=1 261 359 8.0E-06
sp|O76734|TUP1_DICDI General transcriptional corepressor tupA OS=Dictyostelium discoideum GN=tupA PE=2 SV=1 106 359 9.0E-06
sp|Q6DH44|WDR83_DANRE WD repeat domain-containing protein 83 OS=Danio rerio GN=wdr83 PE=2 SV=1 117 359 9.0E-06
sp|A2QPW4|CIAO1_ASPNC Probable cytosolic iron-sulfur protein assembly protein 1 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=cia1 PE=3 SV=1 251 368 9.0E-06
sp|B4P7H8|WDR48_DROYA WD repeat-containing protein 48 homolog OS=Drosophila yakuba GN=GE13034 PE=3 SV=1 63 356 9.0E-06
sp|O75529|TAF5L_HUMAN TAF5-like RNA polymerase II p300/CBP-associated factor-associated factor 65 kDa subunit 5L OS=Homo sapiens GN=TAF5L PE=1 SV=1 170 368 1.0E-05
sp|Q54KL5|WDR5_DICDI WD repeat-containing protein 5 homolog OS=Dictyostelium discoideum GN=wdr5 PE=3 SV=1 285 365 1.0E-05
sp|A8IZG4|CIAO1_CHLRE Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Chlamydomonas reinhardtii GN=CHLREDRAFT_130093 PE=3 SV=1 50 359 1.0E-05
sp|B7FNU7|LIS1_PHATC Lissencephaly-1 homolog OS=Phaeodactylum tricornutum (strain CCAP 1055/1) GN=PHATRDRAFT_17300 PE=3 SV=1 63 362 1.0E-05
sp|Q9XW12|CIAO1_CAEEL Probable cytosolic iron-sulfur protein assembly protein CIAO1 homolog OS=Caenorhabditis elegans GN=Y18D10A.9 PE=1 SV=2 82 360 1.0E-05
sp|Q6P5M2|WDR61_DANRE WD repeat-containing protein 61 OS=Danio rerio GN=wdr61 PE=2 SV=1 65 359 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3906
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4124
Ophiocordyceps australis map64 (Brazil) OphauB2|7679
Ophiocordyceps camponoti-floridani Ophcf2|00494
Ophiocordyceps camponoti-rufipedis Ophun1|6504 (this protein)
Ophiocordyceps kimflemingae Ophio5|8197
Ophiocordyceps subramaniannii Hirsu2|7783

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6504
MKIKALTRPLSSHQPAGNDAPRLPRNLDPAVHPLERAREYQRALNAVKLERMHAAPFIGQLGRGHVDGVYALAKD
PSSTERLASASGDGVVKVWDLAGRRGEEGGEVWHAAAHDNIVKALAWTRDGKLLTCAATDRAVKLFDPYGTQAEA
PPLSSWLGNGPFSSLSHHRSRDAFAAAQSASISVYDLGRHSAAPETLRWPTAVDSITDVSFSPVETSVLASCGAD
RSVVIYDLRTSTPVTKTVLKFASNRVAWSPMEAFNLATASEDHNVYLFDMRRFDRALNVLKDHVAAVMDVEFSPT
GEELVTASWDRTVRLWSRDRGHSRDVYHTKRMQRVMAACWSPDARYVLSGSDDGNVRLWRAKASERSAIKSARHR
QALEYNDALVNRYAHMPEIRRISRHRHVPKVVKKAAEIKSQELKSIKRREENERRHTKKQFNKRRTEREKMVLVQ
EQ*
Coding >Ophun1|6504
ATGAAGATCAAAGCACTCACCCGCCCCCTCTCCTCCCACCAACCAGCCGGCAACGACGCCCCCCGCCTCCCCCGC
AACCTCGACCCAGCCGTCCACCCTCTAGAGCGAGCCCGCGAATACCAACGAGCCCTCAACGCCGTCAAGCTCGAG
CGCATGCACGCCGCGCCCTTCATAGGCCAATTAGGACGCGGCCACGTCGACGGCGTGTACGCGCTGGCCAAGGAC
CCATCGTCAACGGAGCGGCTAGCCAGCGCGAGCGGCGATGGCGTCGTCAAGGTCTGGGATCTGGCGGGTCGGCGC
GGGGAGGAGGGGGGGGAGGTGTGGCATGCGGCTGCTCACGATAATATCGTCAAGGCTTTGGCTTGGACGAGGGAT
GGGAAGCTTTTGACGTGTGCGGCTACGGATCGGGCTGTGAAGCTGTTTGATCCGTATGGGACGCAGGCTGAGGCT
CCGCCGCTGTCTTCCTGGCTCGGCAACGGTCCTTTCTCGAGCCTGTCGCATCATCGGTCGAGGGATGCCTTTGCC
GCTGCGCAGTCGGCTTCCATATCCGTCTATGATCTCGGCAGACACTCAGCCGCGCCCGAGACGCTCCGGTGGCCG
ACGGCCGTCGACTCCATCACCGACGTCTCCTTCAGCCCCGTCGAGACATCAGTGCTAGCCTCGTGCGGCGCCGAC
CGATCCGTCGTCATCTACGATCTCCGCACCTCAACACCCGTCACCAAGACGGTCCTCAAATTCGCCTCCAACCGC
GTCGCCTGGTCACCCATGGAGGCTTTCAACCTAGCGACAGCCTCGGAGGATCACAACGTCTACCTCTTCGACATG
CGCCGCTTCGACCGCGCCCTCAACGTCCTCAAGGATCACGTCGCCGCCGTCATGGACGTCGAGTTCTCCCCCACC
GGCGAGGAGCTCGTCACCGCCTCCTGGGACCGCACCGTCCGCCTCTGGTCCCGCGACCGCGGCCACTCGCGCGAC
GTCTACCACACAAAGCGCATGCAGCGCGTCATGGCAGCCTGCTGGTCCCCCGACGCCCGCTACGTCCTCTCCGGC
TCCGACGACGGCAACGTCCGTCTCTGGCGCGCAAAGGCTTCGGAACGGAGCGCCATCAAGTCCGCCCGCCATCGG
CAAGCCCTCGAGTACAACGACGCCCTTGTCAATCGCTACGCCCACATGCCCGAGATTCGTCGCATCAGTCGTCAC
CGCCATGTCCCCAAGGTGGTCAAGAAGGCGGCCGAGATCAAGTCGCAAGAGCTCAAGAGCATCAAACGCAGGGAG
GAGAACGAGCGTCGTCACACCAAGAAGCAGTTCAACAAGCGCCGAACCGAAAGAGAGAAGATGGTCTTGGTACAA
GAGCAATGA
Transcript >Ophun1|6504
ATGAAGATCAAAGCACTCACCCGCCCCCTCTCCTCCCACCAACCAGCCGGCAACGACGCCCCCCGCCTCCCCCGC
AACCTCGACCCAGCCGTCCACCCTCTAGAGCGAGCCCGCGAATACCAACGAGCCCTCAACGCCGTCAAGCTCGAG
CGCATGCACGCCGCGCCCTTCATAGGCCAATTAGGACGCGGCCACGTCGACGGCGTGTACGCGCTGGCCAAGGAC
CCATCGTCAACGGAGCGGCTAGCCAGCGCGAGCGGCGATGGCGTCGTCAAGGTCTGGGATCTGGCGGGTCGGCGC
GGGGAGGAGGGGGGGGAGGTGTGGCATGCGGCTGCTCACGATAATATCGTCAAGGCTTTGGCTTGGACGAGGGAT
GGGAAGCTTTTGACGTGTGCGGCTACGGATCGGGCTGTGAAGCTGTTTGATCCGTATGGGACGCAGGCTGAGGCT
CCGCCGCTGTCTTCCTGGCTCGGCAACGGTCCTTTCTCGAGCCTGTCGCATCATCGGTCGAGGGATGCCTTTGCC
GCTGCGCAGTCGGCTTCCATATCCGTCTATGATCTCGGCAGACACTCAGCCGCGCCCGAGACGCTCCGGTGGCCG
ACGGCCGTCGACTCCATCACCGACGTCTCCTTCAGCCCCGTCGAGACATCAGTGCTAGCCTCGTGCGGCGCCGAC
CGATCCGTCGTCATCTACGATCTCCGCACCTCAACACCCGTCACCAAGACGGTCCTCAAATTCGCCTCCAACCGC
GTCGCCTGGTCACCCATGGAGGCTTTCAACCTAGCGACAGCCTCGGAGGATCACAACGTCTACCTCTTCGACATG
CGCCGCTTCGACCGCGCCCTCAACGTCCTCAAGGATCACGTCGCCGCCGTCATGGACGTCGAGTTCTCCCCCACC
GGCGAGGAGCTCGTCACCGCCTCCTGGGACCGCACCGTCCGCCTCTGGTCCCGCGACCGCGGCCACTCGCGCGAC
GTCTACCACACAAAGCGCATGCAGCGCGTCATGGCAGCCTGCTGGTCCCCCGACGCCCGCTACGTCCTCTCCGGC
TCCGACGACGGCAACGTCCGTCTCTGGCGCGCAAAGGCTTCGGAACGGAGCGCCATCAAGTCCGCCCGCCATCGG
CAAGCCCTCGAGTACAACGACGCCCTTGTCAATCGCTACGCCCACATGCCCGAGATTCGTCGCATCAGTCGTCAC
CGCCATGTCCCCAAGGTGGTCAAGAAGGCGGCCGAGATCAAGTCGCAAGAGCTCAAGAGCATCAAACGCAGGGAG
GAGAACGAGCGTCGTCACACCAAGAAGCAGTTCAACAAGCGCCGAACCGAAAGAGAGAAGATGGTCTTGGTACAA
GAGCAATGA
Gene >Ophun1|6504
ATGAAGATCAAAGCACTCACCCGCCCCCTCTCCTCCCACCAACCAGCCGGCAACGACGCCCCCCGCCTCCCCCGC
AACCTCGACCCAGCCGTCCACCCTCTAGAGCGAGCCCGCGAATACCAACGAGCCCTCAACGCCGTCAAGCTCGAG
CGCATGCACGCCGCGCCCTTCATAGGCCAATTAGGACGCGGCCACGTCGACGGCGTGTACGCGCTGGCCAAGGAC
CCATCGTCAACGGAGCGGCTAGCCAGCGCGAGCGGCGATGGCGTCGTCAAGGTCTGGGATCTGGCGGGTCGGCGC
GGGGAGGAGGGGGGGGAGGTGTGGCATGCGGCTGCTCACGATAATATCGTCAAGGCTTTGGCTTGGACGAGGGAT
GGGAAGCTTTTGACGTGTGCGGCTACGGATCGGGCTGTGAAGCTGTTTGATCCGTATGGGACGCAGGCTGAGGCT
CCGCCGCTGTCTTCCTGGCTCGGCAACGGTCCTTTCTCGAGCCTGTCGCATCATCGGTCGAGGGATGCCTTTGCC
GCTGCGCAGTCGGCTTCCATATCCGTCTATGATCTCGGCAGACACTCAGCCGCGCCCGAGACGCTCCGGTGGCCG
ACGGCCGTCGACTCCATCACCGACGTCTCCTTCAGCCCCGTCGAGACATCAGTGCTAGCCTCGTGCGGCGCCGAC
CGATCCGTCGTCATCTACGATCTCCGCACCTCAACACCCGTCACCAAGACGGTCCTCAAATTCGCCTCCAACCGC
GTCGCCTGGTCACCCATGGAGGCTTTCAACCTAGCGACAGCCTCGGAGGATCACAACGTCTACCTCTTCGACATG
CGCCGCTTCGACCGCGCCCTCAACGTCCTCAAGGATCACGTCGCCGCCGTCATGGACGTCGAGTTCTCCCCCACC
GGCGAGGAGCTCGTCACCGCCTCCTGGGACCGCACCGTCCGCCTCTGGTCCCGCGACCGCGGCCACTCGCGCGAC
GTCTACCACACAAAGCGCATGCAGCGCGTCATGGCAGCCTGCTGGTCCCCCGACGCCCGCTACGTCCTCTCCGGC
TCCGACGACGGCAACGTCCGTCTCTGGCGCGCAAAGGCTTCGGAACGGAGCGCCATCAAGTCCGCCCGCCATCGG
CAAGCCCTCGAGTACAACGACGCCCTTGTCAATCGCTACGCCCACATGCCCGAGATTCGTCGCATCAGTCGTCAC
CGCCATGTCCCCAAGGTGGTCAAGAAGGCGGCCGAGATCAAGTCGCAAGAGCTCAAGAGCATCAAACGCAGGGAG
GAGAACGAGCGTCGTCACACCAAGAAGCAGTTCAACAAGCGCCGAACCGAAAGAGAGAAGATGGTCTTGGTACAA
GAGCAATGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail