Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6501
Gene name
LocationContig_711:2217..3333
Strand-
Gene length (bp)1116
Transcript length (bp)1116
Coding sequence length (bp)1116
Protein length (aa) 372

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05063 MT-A70 MT-A70 2.4E-30 181 353

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q09800|YAA7_SCHPO Uncharacterized protein C22G7.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC22G7.07c PE=3 SV=2 40 363 2.0E-34
sp|Q8N3J2|METL4_HUMAN Methyltransferase-like protein 4 OS=Homo sapiens GN=METTL4 PE=2 SV=3 145 364 7.0E-34
sp|Q3U034|METL4_MOUSE Methyltransferase-like protein 4 OS=Mus musculus GN=Mettl4 PE=2 SV=1 123 371 6.0E-32
sp|Q8LFA9|METL2_ARATH Methyltransferase-like protein 2 OS=Arabidopsis thaliana GN=At1g19340 PE=2 SV=2 145 364 1.0E-23
sp|Q09956|DAMT1_CAEEL DNA N6-methyl methyltransferase OS=Caenorhabditis elegans GN=damt-1 PE=1 SV=1 140 353 2.0E-21

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3776
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|7187
Ophiocordyceps australis map64 (Brazil) OphauB2|3507
Ophiocordyceps camponoti-floridani Ophcf2|02806
Ophiocordyceps camponoti-rufipedis Ophun1|6501 (this protein)
Ophiocordyceps kimflemingae Ophio5|3706
Ophiocordyceps subramaniannii Hirsu2|7369

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6501
MDGPSASSVHQRVSGTQAPALQHLPRPQGLEPLVSGNQPYRTRPAPMSSSILFRSPDATVVLLDIPRSLEESQVP
AGERPCRRLRSGLLPLAPLPTPEPKSGVVPGPAARLVADLMTAGAVGRALQVLADEYDGPFHLERCSSTVEPDFD
SDDVIVPVGARYICGPLKDTREALIEASPPFDLIVLDPPWPNRSVRRRRSSYNTPSTLPAVRHLLLQVPVAARLA
ANGLVAVWVTNKPAACSLLTSSAGVFAAWGLELVAEWTWLKIAASGEPLYDVDSAWRKPWERLLIAKRRGGCVPR
TLADKIIVAVPDLHSRKPSLRSLFGEVLERDDYVGLEVFARNLTAGWWSWGDEVVKFQRPDCWLPASQEAC*
Coding >Ophun1|6501
ATGGATGGACCTTCAGCCTCGTCCGTTCACCAGCGTGTCTCAGGCACTCAAGCCCCGGCTCTGCAACACCTCCCG
CGCCCCCAAGGCCTTGAGCCTCTTGTCTCAGGCAACCAGCCCTACCGCACACGTCCGGCCCCCATGAGCAGCAGC
ATCCTCTTCCGCAGCCCCGACGCAACCGTCGTCCTGCTCGACATCCCGCGCTCGCTGGAGGAGAGCCAAGTCCCC
GCGGGCGAGAGGCCATGTCGTCGGCTGCGGTCCGGCTTGCTTCCGCTTGCGCCGCTGCCGACGCCGGAGCCCAAG
TCGGGGGTGGTTCCGGGGCCGGCGGCGAGGCTGGTGGCTGACTTGATGACGGCTGGGGCTGTGGGGAGGGCTTTG
CAGGTGCTGGCTGATGAGTACGATGGACCTTTTCATCTTGAACGCTGCTCTTCGACTGTCGAGCCGGACTTCGAC
TCGGACGACGTCATCGTCCCCGTCGGAGCTCGGTATATATGCGGCCCCCTCAAAGACACAAGAGAAGCCCTCATC
GAAGCCTCCCCCCCCTTCGACCTCATCGTCCTCGACCCCCCCTGGCCAAACCGATCCGTCCGCCGCCGCAGATCC
AGCTACAACACACCCAGCACCCTCCCCGCCGTGCGCCACCTCCTCCTCCAAGTTCCCGTCGCAGCCCGCCTCGCA
GCCAACGGCCTCGTCGCCGTCTGGGTAACCAATAAGCCGGCAGCCTGCAGCCTGCTTACGTCGTCCGCTGGCGTC
TTCGCTGCCTGGGGCCTCGAGCTGGTGGCGGAGTGGACGTGGTTGAAGATTGCCGCCTCGGGCGAGCCGCTCTAC
GACGTGGACTCTGCTTGGCGGAAGCCGTGGGAGAGACTTCTTATCGCTAAGCGTCGGGGTGGCTGCGTGCCTCGC
ACTCTGGCGGACAAGATTATCGTCGCTGTGCCGGATTTGCATTCTAGAAAGCCTAGTCTTCGCTCGCTGTTCGGT
GAAGTGCTGGAGCGCGACGACTACGTCGGCCTCGAGGTCTTTGCTCGAAATCTCACGGCTGGGTGGTGGAGCTGG
GGAGACGAGGTGGTCAAGTTTCAGCGGCCGGACTGTTGGCTCCCCGCCTCGCAAGAAGCGTGCTGA
Transcript >Ophun1|6501
ATGGATGGACCTTCAGCCTCGTCCGTTCACCAGCGTGTCTCAGGCACTCAAGCCCCGGCTCTGCAACACCTCCCG
CGCCCCCAAGGCCTTGAGCCTCTTGTCTCAGGCAACCAGCCCTACCGCACACGTCCGGCCCCCATGAGCAGCAGC
ATCCTCTTCCGCAGCCCCGACGCAACCGTCGTCCTGCTCGACATCCCGCGCTCGCTGGAGGAGAGCCAAGTCCCC
GCGGGCGAGAGGCCATGTCGTCGGCTGCGGTCCGGCTTGCTTCCGCTTGCGCCGCTGCCGACGCCGGAGCCCAAG
TCGGGGGTGGTTCCGGGGCCGGCGGCGAGGCTGGTGGCTGACTTGATGACGGCTGGGGCTGTGGGGAGGGCTTTG
CAGGTGCTGGCTGATGAGTACGATGGACCTTTTCATCTTGAACGCTGCTCTTCGACTGTCGAGCCGGACTTCGAC
TCGGACGACGTCATCGTCCCCGTCGGAGCTCGGTATATATGCGGCCCCCTCAAAGACACAAGAGAAGCCCTCATC
GAAGCCTCCCCCCCCTTCGACCTCATCGTCCTCGACCCCCCCTGGCCAAACCGATCCGTCCGCCGCCGCAGATCC
AGCTACAACACACCCAGCACCCTCCCCGCCGTGCGCCACCTCCTCCTCCAAGTTCCCGTCGCAGCCCGCCTCGCA
GCCAACGGCCTCGTCGCCGTCTGGGTAACCAATAAGCCGGCAGCCTGCAGCCTGCTTACGTCGTCCGCTGGCGTC
TTCGCTGCCTGGGGCCTCGAGCTGGTGGCGGAGTGGACGTGGTTGAAGATTGCCGCCTCGGGCGAGCCGCTCTAC
GACGTGGACTCTGCTTGGCGGAAGCCGTGGGAGAGACTTCTTATCGCTAAGCGTCGGGGTGGCTGCGTGCCTCGC
ACTCTGGCGGACAAGATTATCGTCGCTGTGCCGGATTTGCATTCTAGAAAGCCTAGTCTTCGCTCGCTGTTCGGT
GAAGTGCTGGAGCGCGACGACTACGTCGGCCTCGAGGTCTTTGCTCGAAATCTCACGGCTGGGTGGTGGAGCTGG
GGAGACGAGGTGGTCAAGTTTCAGCGGCCGGACTGTTGGCTCCCCGCCTCGCAAGAAGCGTGCTGA
Gene >Ophun1|6501
ATGGATGGACCTTCAGCCTCGTCCGTTCACCAGCGTGTCTCAGGCACTCAAGCCCCGGCTCTGCAACACCTCCCG
CGCCCCCAAGGCCTTGAGCCTCTTGTCTCAGGCAACCAGCCCTACCGCACACGTCCGGCCCCCATGAGCAGCAGC
ATCCTCTTCCGCAGCCCCGACGCAACCGTCGTCCTGCTCGACATCCCGCGCTCGCTGGAGGAGAGCCAAGTCCCC
GCGGGCGAGAGGCCATGTCGTCGGCTGCGGTCCGGCTTGCTTCCGCTTGCGCCGCTGCCGACGCCGGAGCCCAAG
TCGGGGGTGGTTCCGGGGCCGGCGGCGAGGCTGGTGGCTGACTTGATGACGGCTGGGGCTGTGGGGAGGGCTTTG
CAGGTGCTGGCTGATGAGTACGATGGACCTTTTCATCTTGAACGCTGCTCTTCGACTGTCGAGCCGGACTTCGAC
TCGGACGACGTCATCGTCCCCGTCGGAGCTCGGTATATATGCGGCCCCCTCAAAGACACAAGAGAAGCCCTCATC
GAAGCCTCCCCCCCCTTCGACCTCATCGTCCTCGACCCCCCCTGGCCAAACCGATCCGTCCGCCGCCGCAGATCC
AGCTACAACACACCCAGCACCCTCCCCGCCGTGCGCCACCTCCTCCTCCAAGTTCCCGTCGCAGCCCGCCTCGCA
GCCAACGGCCTCGTCGCCGTCTGGGTAACCAATAAGCCGGCAGCCTGCAGCCTGCTTACGTCGTCCGCTGGCGTC
TTCGCTGCCTGGGGCCTCGAGCTGGTGGCGGAGTGGACGTGGTTGAAGATTGCCGCCTCGGGCGAGCCGCTCTAC
GACGTGGACTCTGCTTGGCGGAAGCCGTGGGAGAGACTTCTTATCGCTAAGCGTCGGGGTGGCTGCGTGCCTCGC
ACTCTGGCGGACAAGATTATCGTCGCTGTGCCGGATTTGCATTCTAGAAAGCCTAGTCTTCGCTCGCTGTTCGGT
GAAGTGCTGGAGCGCGACGACTACGTCGGCCTCGAGGTCTTTGCTCGAAATCTCACGGCTGGGTGGTGGAGCTGG
GGAGACGAGGTGGTCAAGTTTCAGCGGCCGGACTGTTGGCTCCCCGCCTCGCAAGAAGCGTGCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail