Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6498
Gene name
LocationContig_710:5488..8267
Strand+
Gene length (bp)2779
Transcript length (bp)2595
Coding sequence length (bp)2595
Protein length (aa) 865

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF12937 F-box-like F-box-like 1.8E-05 26 67
PF00646 F-box F-box domain 8.7E-05 25 59

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup2258
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6661
Ophiocordyceps australis map64 (Brazil) OphauB2|5943
Ophiocordyceps camponoti-floridani Ophcf2|03965
Ophiocordyceps camponoti-rufipedis Ophun1|6498 (this protein)
Ophiocordyceps kimflemingae Ophio5|2919
Ophiocordyceps subramaniannii Hirsu2|2933

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6498
MAANAGGSQPVVVRGPPFNKSSLCFLELPPETQHEIVSHCSQADLVCLALVSKRCRELASAQLYRNFHIVFPDED
DVSFDSPIDGLAGGLDTFTTSDYNYAQHLRDLSMDTLSAGGKAEQSYQPYLYNVSCGKFLNSLLCQTLRKTHSLE
TFRWNIRVELSRPVYRQLHRIASLTRLHVRMQSGASYYCPLPPLPPGSADMHGTNPHPSQPQPPPSPSRSARAER
RGPGHVKAPTFSGFEGLKSLGVLDIESLDVVREIRTCIRNSFSTLKGLQLSLSDSYAQQARSPSIDSDADDSDVD
DDFQVVLSSQNSSYDAGAAVQEERKMQEAILGRIFDVEPRLVRRSPINRRHNGNSTESVETSAPCEGNPRDDFVS
SIKTVSEKLLALQQGSRDFTITHQEMLETIEQAARLYVDSCKRETPNTSTEMAAADATNEYSAERAAAPGESSRR
GTEEQGFSVDSGANDDTMITGSFISDKPCEANADDVDIAYDVETQEEHAPVNKPMSRAPASGSANKAGDSKEFRR
EHRGPSQDAQSRETVQESMEAYVRDTRGLSLESLSIYLVPVKASVLSRGVDVTCLKQLTLLNVGNQTPIWSMLAK
EGRTQPLALRSVFTDHVTPTFLTCMAQLPELHDLFLLGRSVKHKPESFAPRVSTTMDQIRRLVLKKHMATLKRLM
IKDESLESNWDANEKTMILICCRGVKLEELALSMNIKALHAFMQYLSGLVSLRAVSILRFKNGDTCMWVMREILR
FIVDNLSHHPELKLEWIAMDDDHVDRVVRPSEASDDEAEKKPAKKRSKGKGNAVAVDGTYPPLPTDGLDSESSSD
EDERCDGGTKLRFKTVGPLQFYDVWGVRIFEKEVRSGRL*
Coding >Ophun1|6498
ATGGCAGCCAATGCCGGCGGCAGCCAGCCGGTGGTCGTCCGGGGACCGCCGTTTAATAAGTCTTCACTCTGCTTT
CTGGAATTGCCGCCCGAAACGCAGCACGAAATTGTGTCCCATTGCTCTCAGGCGGATCTTGTTTGTCTCGCTCTC
GTTAGCAAGCGCTGTCGTGAGTTGGCTTCGGCCCAGCTCTATCGCAACTTTCACATCGTCTTTCCAGACGAAGAC
GACGTCAGCTTCGACTCTCCAATAGACGGTCTGGCTGGCGGCCTCGATACCTTTACTACCAGCGACTACAACTAT
GCGCAGCATCTGAGGGACCTGTCTATGGACACTTTGAGCGCCGGAGGCAAGGCTGAGCAGTCCTACCAGCCATAT
CTGTATAACGTCAGTTGTGGCAAGTTTCTCAACAGCTTGCTCTGTCAGACTCTCAGGAAGACACATTCTTTAGAG
ACTTTCCGTTGGAATATTCGCGTCGAGCTCAGCCGGCCCGTTTATCGTCAACTCCACCGAATCGCCTCCTTGACG
CGACTTCACGTGCGCATGCAGTCTGGTGCCTCATATTACTGTCCGCTGCCGCCGCTGCCGCCAGGCTCTGCAGAC
ATGCACGGCACCAACCCTCACCCATCTCAGCCCCAGCCGCCCCCGTCGCCGTCCAGGTCTGCAAGGGCCGAGAGA
CGCGGCCCGGGGCACGTCAAGGCACCTACGTTCTCCGGGTTCGAGGGCCTCAAGAGCCTAGGCGTATTGGACATT
GAATCTCTCGATGTCGTCCGTGAGATTAGGACGTGCATTCGTAACTCCTTTTCCACCCTCAAGGGACTGCAGCTG
TCTCTGTCCGACTCCTACGCTCAGCAGGCTCGATCGCCATCAATTGATTCGGACGCTGACGACTCTGATGTCGAC
GACGACTTTCAGGTCGTCCTCTCATCACAAAACTCCAGCTATGATGCCGGCGCCGCCGTACAGGAGGAGCGCAAG
ATGCAAGAGGCGATTCTCGGCAGGATATTCGACGTTGAGCCAAGGTTGGTCAGGAGGTCGCCCATCAACAGGAGG
CACAACGGGAACTCGACGGAAAGTGTCGAGACTTCAGCACCCTGCGAAGGGAATCCTCGCGACGATTTCGTCTCA
TCCATCAAGACTGTTTCGGAGAAGCTCTTGGCTCTCCAGCAGGGAAGCAGGGATTTCACCATCACTCATCAAGAG
ATGCTGGAAACCATTGAGCAGGCCGCGAGGCTCTACGTCGACTCGTGCAAGCGTGAGACACCTAACACCTCTACT
GAGATGGCCGCCGCAGACGCCACGAACGAGTACTCTGCGGAGCGTGCCGCAGCGCCAGGCGAGTCCAGCCGAAGG
GGTACCGAGGAGCAGGGATTCTCTGTCGATAGCGGCGCCAACGACGACACCATGATTACGGGGTCATTCATCAGC
GATAAGCCTTGCGAGGCCAATGCCGACGACGTTGACATTGCGTACGACGTAGAGACGCAGGAAGAGCATGCTCCT
GTGAACAAGCCGATGTCACGAGCTCCCGCTTCTGGTTCTGCGAATAAGGCCGGCGACAGCAAGGAATTCCGGCGG
GAGCACAGGGGTCCGTCGCAAGACGCCCAGTCGAGAGAGACGGTCCAAGAGTCAATGGAAGCCTACGTGCGCGAC
ACACGGGGGCTGTCGCTGGAGTCGCTCAGCATCTATCTGGTGCCGGTTAAGGCATCGGTGCTATCGCGAGGAGTC
GACGTGACCTGTCTGAAGCAGCTGACGCTCCTCAACGTCGGCAATCAGACGCCCATCTGGTCTATGCTGGCCAAG
GAGGGCCGGACGCAACCATTGGCTTTGCGAAGCGTCTTTACCGATCACGTCACGCCGACCTTTCTCACGTGCATG
GCACAGCTCCCGGAGCTTCACGATCTGTTTCTCCTCGGGCGGAGTGTTAAGCACAAGCCGGAGAGCTTTGCGCCT
CGGGTGTCGACGACGATGGATCAGATTAGACGTTTGGTGCTGAAGAAGCACATGGCGACGCTGAAGCGGTTGATG
ATTAAAGACGAGTCGTTGGAATCTAACTGGGACGCTAATGAGAAGACCATGATTCTCATCTGCTGCCGCGGTGTG
AAGCTGGAGGAGTTGGCGCTGAGTATGAATATTAAAGCCTTGCACGCTTTCATGCAGTATCTATCAGGCCTCGTC
AGCCTACGAGCCGTCAGCATCTTACGGTTTAAGAACGGCGACACGTGCATGTGGGTGATGCGAGAGATTCTGCGC
TTCATCGTCGACAACCTCTCGCACCATCCAGAGCTCAAGCTGGAGTGGATCGCCATGGACGACGACCACGTGGAC
CGGGTGGTGCGTCCATCGGAGGCAAGCGACGACGAGGCCGAGAAGAAGCCCGCCAAGAAGAGATCCAAGGGCAAA
GGAAACGCCGTGGCCGTCGACGGCACGTACCCGCCCTTGCCAACGGACGGGCTGGACTCGGAGAGCTCGAGCGAC
GAGGACGAGCGCTGCGACGGAGGGACGAAGCTGCGGTTCAAGACGGTCGGACCGCTGCAGTTCTACGACGTTTGG
GGGGTGCGTATCTTTGAAAAGGAGGTTCGGAGCGGGAGGCTTTAG
Transcript >Ophun1|6498
ATGGCAGCCAATGCCGGCGGCAGCCAGCCGGTGGTCGTCCGGGGACCGCCGTTTAATAAGTCTTCACTCTGCTTT
CTGGAATTGCCGCCCGAAACGCAGCACGAAATTGTGTCCCATTGCTCTCAGGCGGATCTTGTTTGTCTCGCTCTC
GTTAGCAAGCGCTGTCGTGAGTTGGCTTCGGCCCAGCTCTATCGCAACTTTCACATCGTCTTTCCAGACGAAGAC
GACGTCAGCTTCGACTCTCCAATAGACGGTCTGGCTGGCGGCCTCGATACCTTTACTACCAGCGACTACAACTAT
GCGCAGCATCTGAGGGACCTGTCTATGGACACTTTGAGCGCCGGAGGCAAGGCTGAGCAGTCCTACCAGCCATAT
CTGTATAACGTCAGTTGTGGCAAGTTTCTCAACAGCTTGCTCTGTCAGACTCTCAGGAAGACACATTCTTTAGAG
ACTTTCCGTTGGAATATTCGCGTCGAGCTCAGCCGGCCCGTTTATCGTCAACTCCACCGAATCGCCTCCTTGACG
CGACTTCACGTGCGCATGCAGTCTGGTGCCTCATATTACTGTCCGCTGCCGCCGCTGCCGCCAGGCTCTGCAGAC
ATGCACGGCACCAACCCTCACCCATCTCAGCCCCAGCCGCCCCCGTCGCCGTCCAGGTCTGCAAGGGCCGAGAGA
CGCGGCCCGGGGCACGTCAAGGCACCTACGTTCTCCGGGTTCGAGGGCCTCAAGAGCCTAGGCGTATTGGACATT
GAATCTCTCGATGTCGTCCGTGAGATTAGGACGTGCATTCGTAACTCCTTTTCCACCCTCAAGGGACTGCAGCTG
TCTCTGTCCGACTCCTACGCTCAGCAGGCTCGATCGCCATCAATTGATTCGGACGCTGACGACTCTGATGTCGAC
GACGACTTTCAGGTCGTCCTCTCATCACAAAACTCCAGCTATGATGCCGGCGCCGCCGTACAGGAGGAGCGCAAG
ATGCAAGAGGCGATTCTCGGCAGGATATTCGACGTTGAGCCAAGGTTGGTCAGGAGGTCGCCCATCAACAGGAGG
CACAACGGGAACTCGACGGAAAGTGTCGAGACTTCAGCACCCTGCGAAGGGAATCCTCGCGACGATTTCGTCTCA
TCCATCAAGACTGTTTCGGAGAAGCTCTTGGCTCTCCAGCAGGGAAGCAGGGATTTCACCATCACTCATCAAGAG
ATGCTGGAAACCATTGAGCAGGCCGCGAGGCTCTACGTCGACTCGTGCAAGCGTGAGACACCTAACACCTCTACT
GAGATGGCCGCCGCAGACGCCACGAACGAGTACTCTGCGGAGCGTGCCGCAGCGCCAGGCGAGTCCAGCCGAAGG
GGTACCGAGGAGCAGGGATTCTCTGTCGATAGCGGCGCCAACGACGACACCATGATTACGGGGTCATTCATCAGC
GATAAGCCTTGCGAGGCCAATGCCGACGACGTTGACATTGCGTACGACGTAGAGACGCAGGAAGAGCATGCTCCT
GTGAACAAGCCGATGTCACGAGCTCCCGCTTCTGGTTCTGCGAATAAGGCCGGCGACAGCAAGGAATTCCGGCGG
GAGCACAGGGGTCCGTCGCAAGACGCCCAGTCGAGAGAGACGGTCCAAGAGTCAATGGAAGCCTACGTGCGCGAC
ACACGGGGGCTGTCGCTGGAGTCGCTCAGCATCTATCTGGTGCCGGTTAAGGCATCGGTGCTATCGCGAGGAGTC
GACGTGACCTGTCTGAAGCAGCTGACGCTCCTCAACGTCGGCAATCAGACGCCCATCTGGTCTATGCTGGCCAAG
GAGGGCCGGACGCAACCATTGGCTTTGCGAAGCGTCTTTACCGATCACGTCACGCCGACCTTTCTCACGTGCATG
GCACAGCTCCCGGAGCTTCACGATCTGTTTCTCCTCGGGCGGAGTGTTAAGCACAAGCCGGAGAGCTTTGCGCCT
CGGGTGTCGACGACGATGGATCAGATTAGACGTTTGGTGCTGAAGAAGCACATGGCGACGCTGAAGCGGTTGATG
ATTAAAGACGAGTCGTTGGAATCTAACTGGGACGCTAATGAGAAGACCATGATTCTCATCTGCTGCCGCGGTGTG
AAGCTGGAGGAGTTGGCGCTGAGTATGAATATTAAAGCCTTGCACGCTTTCATGCAGTATCTATCAGGCCTCGTC
AGCCTACGAGCCGTCAGCATCTTACGGTTTAAGAACGGCGACACGTGCATGTGGGTGATGCGAGAGATTCTGCGC
TTCATCGTCGACAACCTCTCGCACCATCCAGAGCTCAAGCTGGAGTGGATCGCCATGGACGACGACCACGTGGAC
CGGGTGGTGCGTCCATCGGAGGCAAGCGACGACGAGGCCGAGAAGAAGCCCGCCAAGAAGAGATCCAAGGGCAAA
GGAAACGCCGTGGCCGTCGACGGCACGTACCCGCCCTTGCCAACGGACGGGCTGGACTCGGAGAGCTCGAGCGAC
GAGGACGAGCGCTGCGACGGAGGGACGAAGCTGCGGTTCAAGACGGTCGGACCGCTGCAGTTCTACGACGTTTGG
GGGGTGCGTATCTTTGAAAAGGAGGTTCGGAGCGGGAGGCTTTAG
Gene >Ophun1|6498
ATGGCAGCCAATGCCGGCGGCAGCCAGCCGGTGGTCGTCCGGGGACCGCCGTTTAATAAGTCTTCACTCTGCTTT
CTGGAATTGCCGCCCGAAACGCAGCACGAAATTGTGTCCCATGTGCGCGGCCAGATCCCCAACACCTCTTCCCCC
CCTTTTTCTTCTGGTGGTCGCTGACATGAACTTTAGTGCTCTCAGGCGGATCTTGTTTGTCTCGCTCTCGTTAGC
AAGCGCTGTCGTGAGTTGGCTTCGGCCCAGCTCTATCGCAACTTTCACATCGTCTTTCCAGACGAAGACGACGTC
AGCTTCGACTCTCCAATAGACGGTCTGGCTGGCGGCCTCGATACCTTTACTACCAGCGACTACAACTATGCGCAG
CATCTGAGGGACCTGTCTATGGACACTTTGAGCGCCGGAGGCAAGGCTGAGCAGTCCTACCAGCCATATCTGTAT
AACGTCAGTTGTGGCAAGTTTCTCAACAGCTTGCTCTGTCAGACTCTCAGGAAGACACATTCTTTAGAGACTTTC
CGGTCAGAATTCCCTTTCTTCCTGGCCTCAATTGCTGAGCTCACCCTGTGCTGCCTAATAGTTGGAATATTCGCG
TCGAGCTCAGCCGGCCCGTTTATCGTCAACTCCACCGAATCGCCTCCTTGACGCGACTTCACGTGCGCATGCAGT
CTGGTGCCTCATATTACTGTCCGCTGCCGCCGCTGCCGCCAGGCTCTGCAGACATGCACGGCACCAACCCTCACC
CATCTCAGCCCCAGCCGCCCCCGTCGCCGTCCAGGTCTGCAAGGGCCGAGAGACGCGGCCCGGGGCACGTCAAGG
CACCTACGTTCTCCGGGTTCGAGGGCCTCAAGAGCCTAGGCGTATTGGACATTGAATCTCTCGATGTCGTCCGTG
AGATTAGGACGTGCATTCGTAACTCCTTTTCCACCCTCAAGGGACTGCAGCTGTCTCTGTCCGACTCCTACGCTC
AGCAGGCTCGATCGCCATCAATTGATTCGGACGCTGACGACTCTGATGTCGACGACGACTTTCAGGTCGTCCTCT
CATCACAAAACTCCAGCTATGATGCCGGCGCCGCCGTACAGGAGGAGCGCAAGATGCAAGAGGCGATTCTCGGCA
GGATATTCGACGTTGAGCCAAGGTTGGTCAGGAGGTCGCCCATCAACAGGAGGCACAACGGGAACTCGACGGAAA
GTGTCGAGACTTCAGCACCCTGCGAAGGGAATCCTCGCGACGATTTCGTCTCATCCATCAAGACTGTTTCGGAGA
AGCTCTTGGCTCTCCAGCAGGGAAGCAGGGATTTCACCATCACTCATCAAGAGATGCTGGAAACCATTGAGCAGG
CCGCGAGGCTCTACGTCGACTCGTGCAAGCGTGAGACACCTAACACCTCTACTGAGATGGCCGCCGCAGACGCCA
CGAACGAGTACTCTGCGGAGCGTGCCGCAGCGCCAGGCGAGTCCAGCCGAAGGGGTACCGAGGAGCAGGGATTCT
CTGTCGATAGCGGCGCCAACGACGACACCATGATTACGGGGTCATTCATCAGCGATAAGCCTTGCGAGGCCAATG
CCGACGACGTTGACATTGCGTACGACGTAGAGACGCAGGAAGAGCATGCTCCTGTGAACAAGCCGATGTCACGAG
CTCCCGCTTCTGGTTCTGCGAATAAGGCCGGCGACAGCAAGGAATTCCGGCGGGAGCACAGGGGTCCGTCGCAAG
ACGCCCAGTCGAGAGAGACGGTCCAAGAGTCAATGGAAGCCTACGTGCGCGACACACGGGGGCTGTCGCTGGAGT
CGCTCAGCATCTATCTGGTGCCGGTTAAGGCATCGGTGCTATCGCGAGGAGTCGACGTGACCTGTCTGAAGCAGC
TGACGCTCCTCAACGTCGGCAATCAGACGCCCATCTGGTCTATGCTGGCCAAGGAGGGCCGGACGCAACCATTGG
CTTTGCGAAGCGTCTTTACCGATCACGTCACGCCGACCTTTCTCACGTGCATGGCACAGCTCCCGGAGCTTCACG
ATCTGTTTCTCCTCGGGCGGAGTGTTAAGCACAAGCCGGAGAGCTTTGCGCCTCGGGTGTCGACGACGATGGATC
AGATTAGACGTTTGGTGCTGAAGAAGCACATGGCGACGCTGAAGCGGTTGATGATTAAAGACGAGTCGTTGGAAT
CTAACTGGGACGCTAATGAGAAGACCATGATTCTCATCTGCTGCCGCGGTGTGAAGCTGGAGGAGTTGGCGCTGA
GTATGAATATTAAAGCCTTGGTGAGTCCTCCCCCCCCCCCTTTACTCTACTCTCGCTGACGGTCTCCATCGGGCA
GCACGCTTTCATGCAGTATCTATCAGGCCTCGTCAGCCTACGAGCCGTCAGCATCTTACGGTTTAAGAACGGCGA
CACGTGCATGTGGGTGATGCGAGAGATTCTGCGCTTCATCGTCGACAACCTCTCGCACCATCCAGAGCTCAAGCT
GGAGTGGATCGCCATGGACGACGACCACGTGGACCGGGTGGTGCGTCCATCGGAGGCAAGCGACGACGAGGCCGA
GAAGAAGCCCGCCAAGAAGAGATCCAAGGGCAAAGGAAACGCCGTGGCCGTCGACGGCACGTACCCGCCCTTGCC
AACGGACGGGCTGGACTCGGAGAGCTCGAGCGACGAGGACGAGCGCTGCGACGGAGGGACGAAGCTGCGGTTCAA
GACGGTCGGACCGCTGCAGTTCTACGACGTTTGGGGGGTGCGTATCTTTGAAAAGGAGGTTCGGAGCGGGAGGCT
TTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail