Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6496
Gene name
LocationContig_710:598..2551
Strand-
Gene length (bp)1953
Transcript length (bp)1953
Coding sequence length (bp)1953
Protein length (aa) 651

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01841 Transglut_core Transglutaminase-like superfamily 3.0E-10 342 448

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q8C8H8|KY_MOUSE Kyphoscoliosis peptidase OS=Mus musculus GN=Ky PE=1 SV=1 331 492 2.0E-15
sp|Q8NBH2|KY_HUMAN Kyphoscoliosis peptidase OS=Homo sapiens GN=KY PE=1 SV=2 344 492 2.0E-14

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup3470
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|6660
Ophiocordyceps australis map64 (Brazil) OphauB2|5944
Ophiocordyceps camponoti-floridani Ophcf2|03967
Ophiocordyceps camponoti-rufipedis Ophun1|6496 (this protein)
Ophiocordyceps kimflemingae Ophio5|2921
Ophiocordyceps subramaniannii Hirsu2|663

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6496
MAEVEEVQFNSLADRIAALGKQKNFNPGAEPVRKRPPPPPPPTVKPVVKADDETAVSPPPGPGRPCPPPPPARRD
GRPPPPPPPARSSTASRPVPPPLPRRTSTQSGAMVLRRDSNSSEASQQSVLSPFSPGRKSSTLSLKSQEGSRPRS
MAPAACDPSNLPPLPPSRRESEAKAKEAKAQRMAMARVPSTPTSPASPPKPTLPPRLPLRPVSKPDVAGSATNVL
DQAKKAARKLPPTVIRGFGSSTSTSTSTPAPTKTPVDDDDDAAPPPLPLSSRPSAAEIDAVSTRAVSTQPQQTDC
CWICRDWSGPDGVAAQYPRTSLPRNDPVGYLARALCDPFPSYTDKARAIFTWFHHNILYDTEAFFGNNVRHKSVE
DTIFTGKAVCQGYAETYKAIANRAGLDCIVVGGHGKGFGHVALKKGQKPPPAKPDGHAWNAVRIDGGDWKLIDAC
WGAGHISGADQTYTKEFAPEQFTRSNEKFGLRHFPQNPSHQFRSDGRTVSWEEYYRGPSDGEPPVFFTDGHREGI
AEDSVSPREREIAVHSGQVIRFQFSKVCEHWTSEKNGLGRAPLLLLSIHGVDGGRDDMVPMESNGFWHWVDVRAC
DLGAPGQSVEVVQVTQMDGRDARGVTAGEFLAKRGRVGMAWAYVMKWELV*
Coding >Ophun1|6496
ATGGCGGAAGTCGAGGAAGTTCAGTTCAACTCCCTCGCCGATCGCATCGCTGCTCTCGGCAAGCAAAAGAACTTT
AACCCCGGCGCCGAACCCGTTCGCAAGAGACCACCGCCTCCTCCTCCCCCTACGGTCAAGCCGGTCGTGAAGGCC
GATGATGAGACAGCCGTGTCTCCGCCTCCGGGTCCGGGGAGACCCTGTCCGCCTCCACCGCCGGCTCGTCGCGAT
GGCCGTCCTCCGCCGCCGCCTCCGCCTGCCCGATCGTCGACGGCGTCTCGGCCGGTGCCGCCTCCGCTGCCTCGC
CGGACTTCGACTCAGTCCGGCGCCATGGTGCTGAGGCGGGACTCGAATTCGTCCGAGGCGTCGCAGCAGTCGGTC
CTGTCGCCCTTTTCACCGGGTCGAAAATCGTCTACCCTGAGTTTGAAATCTCAAGAGGGCTCTCGTCCGCGAAGC
ATGGCCCCGGCAGCCTGCGACCCGTCCAACCTGCCTCCGCTGCCGCCATCGAGACGAGAGTCAGAAGCCAAGGCC
AAGGAGGCCAAGGCGCAGCGCATGGCCATGGCCAGAGTCCCATCCACACCTACCAGCCCAGCCTCGCCACCGAAG
CCTACTCTCCCGCCCAGATTGCCGTTACGGCCCGTTTCAAAGCCCGATGTCGCAGGCTCGGCTACAAATGTATTG
GATCAGGCCAAGAAGGCGGCTAGGAAATTACCTCCTACAGTCATCAGGGGTTTCGGCAGCAGTACGTCAACGTCG
ACGTCGACGCCCGCTCCTACGAAAACTCCCGTCGATGACGACGATGATGCCGCTCCTCCGCCGCTGCCCCTCAGC
TCGCGACCTTCGGCTGCCGAGATCGACGCTGTATCGACGAGGGCGGTCAGCACTCAGCCGCAGCAGACCGACTGC
TGCTGGATCTGTCGGGACTGGAGTGGCCCCGACGGCGTTGCGGCGCAATATCCCAGAACATCTCTCCCTCGCAAC
GACCCGGTCGGATACTTGGCCCGCGCGCTCTGCGACCCGTTCCCATCGTACACGGACAAGGCCAGAGCCATCTTC
ACCTGGTTTCACCACAACATCCTGTACGACACGGAAGCCTTTTTCGGCAACAACGTGCGGCACAAGTCGGTCGAG
GACACCATCTTCACTGGAAAAGCCGTCTGCCAGGGATACGCCGAGACGTACAAGGCGATTGCCAACCGAGCCGGA
CTGGACTGCATCGTCGTGGGCGGCCACGGCAAAGGCTTCGGCCACGTGGCGCTGAAGAAGGGCCAGAAGCCACCA
CCAGCCAAGCCAGACGGCCACGCATGGAACGCGGTCCGCATCGACGGCGGCGACTGGAAGCTCATCGACGCCTGC
TGGGGAGCGGGCCACATCTCCGGCGCAGACCAGACGTACACGAAGGAATTCGCGCCGGAGCAGTTCACGCGCAGC
AACGAAAAGTTCGGCCTCCGACACTTCCCGCAGAACCCGAGCCATCAGTTCCGCTCCGACGGGCGGACAGTCTCG
TGGGAGGAGTACTACCGCGGCCCCTCGGACGGCGAGCCCCCCGTCTTCTTCACCGACGGACACCGCGAAGGCATC
GCCGAAGACAGCGTCTCCCCCCGCGAGCGCGAAATCGCCGTCCACAGCGGACAGGTAATCCGCTTCCAGTTCTCC
AAGGTCTGCGAGCACTGGACCTCTGAGAAGAACGGGCTCGGACGTGCCCCCTTGCTCCTCCTCAGCATCCACGGC
GTCGACGGCGGGAGAGATGACATGGTGCCGATGGAGAGCAATGGGTTTTGGCATTGGGTTGATGTCAGGGCTTGT
GATTTGGGGGCGCCGGGTCAGTCGGTTGAGGTGGTGCAGGTTACGCAGATGGATGGGCGGGATGCGAGGGGGGTT
ACGGCGGGGGAGTTTCTGGCTAAGAGGGGGAGGGTTGGGATGGCGTGGGCGTATGTGATGAAGTGGGAGCTTGTG
TGA
Transcript >Ophun1|6496
ATGGCGGAAGTCGAGGAAGTTCAGTTCAACTCCCTCGCCGATCGCATCGCTGCTCTCGGCAAGCAAAAGAACTTT
AACCCCGGCGCCGAACCCGTTCGCAAGAGACCACCGCCTCCTCCTCCCCCTACGGTCAAGCCGGTCGTGAAGGCC
GATGATGAGACAGCCGTGTCTCCGCCTCCGGGTCCGGGGAGACCCTGTCCGCCTCCACCGCCGGCTCGTCGCGAT
GGCCGTCCTCCGCCGCCGCCTCCGCCTGCCCGATCGTCGACGGCGTCTCGGCCGGTGCCGCCTCCGCTGCCTCGC
CGGACTTCGACTCAGTCCGGCGCCATGGTGCTGAGGCGGGACTCGAATTCGTCCGAGGCGTCGCAGCAGTCGGTC
CTGTCGCCCTTTTCACCGGGTCGAAAATCGTCTACCCTGAGTTTGAAATCTCAAGAGGGCTCTCGTCCGCGAAGC
ATGGCCCCGGCAGCCTGCGACCCGTCCAACCTGCCTCCGCTGCCGCCATCGAGACGAGAGTCAGAAGCCAAGGCC
AAGGAGGCCAAGGCGCAGCGCATGGCCATGGCCAGAGTCCCATCCACACCTACCAGCCCAGCCTCGCCACCGAAG
CCTACTCTCCCGCCCAGATTGCCGTTACGGCCCGTTTCAAAGCCCGATGTCGCAGGCTCGGCTACAAATGTATTG
GATCAGGCCAAGAAGGCGGCTAGGAAATTACCTCCTACAGTCATCAGGGGTTTCGGCAGCAGTACGTCAACGTCG
ACGTCGACGCCCGCTCCTACGAAAACTCCCGTCGATGACGACGATGATGCCGCTCCTCCGCCGCTGCCCCTCAGC
TCGCGACCTTCGGCTGCCGAGATCGACGCTGTATCGACGAGGGCGGTCAGCACTCAGCCGCAGCAGACCGACTGC
TGCTGGATCTGTCGGGACTGGAGTGGCCCCGACGGCGTTGCGGCGCAATATCCCAGAACATCTCTCCCTCGCAAC
GACCCGGTCGGATACTTGGCCCGCGCGCTCTGCGACCCGTTCCCATCGTACACGGACAAGGCCAGAGCCATCTTC
ACCTGGTTTCACCACAACATCCTGTACGACACGGAAGCCTTTTTCGGCAACAACGTGCGGCACAAGTCGGTCGAG
GACACCATCTTCACTGGAAAAGCCGTCTGCCAGGGATACGCCGAGACGTACAAGGCGATTGCCAACCGAGCCGGA
CTGGACTGCATCGTCGTGGGCGGCCACGGCAAAGGCTTCGGCCACGTGGCGCTGAAGAAGGGCCAGAAGCCACCA
CCAGCCAAGCCAGACGGCCACGCATGGAACGCGGTCCGCATCGACGGCGGCGACTGGAAGCTCATCGACGCCTGC
TGGGGAGCGGGCCACATCTCCGGCGCAGACCAGACGTACACGAAGGAATTCGCGCCGGAGCAGTTCACGCGCAGC
AACGAAAAGTTCGGCCTCCGACACTTCCCGCAGAACCCGAGCCATCAGTTCCGCTCCGACGGGCGGACAGTCTCG
TGGGAGGAGTACTACCGCGGCCCCTCGGACGGCGAGCCCCCCGTCTTCTTCACCGACGGACACCGCGAAGGCATC
GCCGAAGACAGCGTCTCCCCCCGCGAGCGCGAAATCGCCGTCCACAGCGGACAGGTAATCCGCTTCCAGTTCTCC
AAGGTCTGCGAGCACTGGACCTCTGAGAAGAACGGGCTCGGACGTGCCCCCTTGCTCCTCCTCAGCATCCACGGC
GTCGACGGCGGGAGAGATGACATGGTGCCGATGGAGAGCAATGGGTTTTGGCATTGGGTTGATGTCAGGGCTTGT
GATTTGGGGGCGCCGGGTCAGTCGGTTGAGGTGGTGCAGGTTACGCAGATGGATGGGCGGGATGCGAGGGGGGTT
ACGGCGGGGGAGTTTCTGGCTAAGAGGGGGAGGGTTGGGATGGCGTGGGCGTATGTGATGAAGTGGGAGCTTGTG
TGA
Gene >Ophun1|6496
ATGGCGGAAGTCGAGGAAGTTCAGTTCAACTCCCTCGCCGATCGCATCGCTGCTCTCGGCAAGCAAAAGAACTTT
AACCCCGGCGCCGAACCCGTTCGCAAGAGACCACCGCCTCCTCCTCCCCCTACGGTCAAGCCGGTCGTGAAGGCC
GATGATGAGACAGCCGTGTCTCCGCCTCCGGGTCCGGGGAGACCCTGTCCGCCTCCACCGCCGGCTCGTCGCGAT
GGCCGTCCTCCGCCGCCGCCTCCGCCTGCCCGATCGTCGACGGCGTCTCGGCCGGTGCCGCCTCCGCTGCCTCGC
CGGACTTCGACTCAGTCCGGCGCCATGGTGCTGAGGCGGGACTCGAATTCGTCCGAGGCGTCGCAGCAGTCGGTC
CTGTCGCCCTTTTCACCGGGTCGAAAATCGTCTACCCTGAGTTTGAAATCTCAAGAGGGCTCTCGTCCGCGAAGC
ATGGCCCCGGCAGCCTGCGACCCGTCCAACCTGCCTCCGCTGCCGCCATCGAGACGAGAGTCAGAAGCCAAGGCC
AAGGAGGCCAAGGCGCAGCGCATGGCCATGGCCAGAGTCCCATCCACACCTACCAGCCCAGCCTCGCCACCGAAG
CCTACTCTCCCGCCCAGATTGCCGTTACGGCCCGTTTCAAAGCCCGATGTCGCAGGCTCGGCTACAAATGTATTG
GATCAGGCCAAGAAGGCGGCTAGGAAATTACCTCCTACAGTCATCAGGGGTTTCGGCAGCAGTACGTCAACGTCG
ACGTCGACGCCCGCTCCTACGAAAACTCCCGTCGATGACGACGATGATGCCGCTCCTCCGCCGCTGCCCCTCAGC
TCGCGACCTTCGGCTGCCGAGATCGACGCTGTATCGACGAGGGCGGTCAGCACTCAGCCGCAGCAGACCGACTGC
TGCTGGATCTGTCGGGACTGGAGTGGCCCCGACGGCGTTGCGGCGCAATATCCCAGAACATCTCTCCCTCGCAAC
GACCCGGTCGGATACTTGGCCCGCGCGCTCTGCGACCCGTTCCCATCGTACACGGACAAGGCCAGAGCCATCTTC
ACCTGGTTTCACCACAACATCCTGTACGACACGGAAGCCTTTTTCGGCAACAACGTGCGGCACAAGTCGGTCGAG
GACACCATCTTCACTGGAAAAGCCGTCTGCCAGGGATACGCCGAGACGTACAAGGCGATTGCCAACCGAGCCGGA
CTGGACTGCATCGTCGTGGGCGGCCACGGCAAAGGCTTCGGCCACGTGGCGCTGAAGAAGGGCCAGAAGCCACCA
CCAGCCAAGCCAGACGGCCACGCATGGAACGCGGTCCGCATCGACGGCGGCGACTGGAAGCTCATCGACGCCTGC
TGGGGAGCGGGCCACATCTCCGGCGCAGACCAGACGTACACGAAGGAATTCGCGCCGGAGCAGTTCACGCGCAGC
AACGAAAAGTTCGGCCTCCGACACTTCCCGCAGAACCCGAGCCATCAGTTCCGCTCCGACGGGCGGACAGTCTCG
TGGGAGGAGTACTACCGCGGCCCCTCGGACGGCGAGCCCCCCGTCTTCTTCACCGACGGACACCGCGAAGGCATC
GCCGAAGACAGCGTCTCCCCCCGCGAGCGCGAAATCGCCGTCCACAGCGGACAGGTAATCCGCTTCCAGTTCTCC
AAGGTCTGCGAGCACTGGACCTCTGAGAAGAACGGGCTCGGACGTGCCCCCTTGCTCCTCCTCAGCATCCACGGC
GTCGACGGCGGGAGAGATGACATGGTGCCGATGGAGAGCAATGGGTTTTGGCATTGGGTTGATGTCAGGGCTTGT
GATTTGGGGGCGCCGGGTCAGTCGGTTGAGGTGGTGCAGGTTACGCAGATGGATGGGCGGGATGCGAGGGGGGTT
ACGGCGGGGGAGTTTCTGGCTAAGAGGGGGAGGGTTGGGATGGCGTGGGCGTATGTGATGAAGTGGGAGCTTGTG
TGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail