Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6495
Gene name
LocationContig_71:40838..44467
Strand+
Gene length (bp)3629
Transcript length (bp)3567
Coding sequence length (bp)3567
Protein length (aa) 1189

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02714 RSN1_7TM Calcium-dependent channel, 7TM region, putative phosphate 7.9E-71 701 980
PF13967 RSN1_TM Late exocytosis, associated with Golgi transport 1.4E-42 25 205
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 2.2E-07 229 306
PF14703 PHM7_cyt Cytosolic domain of 10TM putative phosphate transporter 5.6E-16 561 688
PF12621 PHM7_ext Extracellular tail, of 10TM putative phosphate transporter 1.2E-14 1101 1179

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 583 1026 4.0E-75
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 536 1183 3.0E-70
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 549 1027 2.0E-53
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 644 1008 6.0E-29
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 610 979 2.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 583 1026 4.0E-75
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 536 1183 3.0E-70
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 549 1027 2.0E-53
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 644 1008 6.0E-29
sp|Q09809|CSC1_SCHPO Calcium permeable stress-gated cation channel 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC2G11.09 PE=3 SV=2 610 979 2.0E-23
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 612 1036 2.0E-23
sp|Q9FVQ5|CSCL1_ARATH CSC1-like protein At1g32090 OS=Arabidopsis thaliana GN=At1g32090 PE=1 SV=1 612 979 5.0E-23
sp|B5TYT3|CSCL7_ARATH CSC1-like protein At1g11960 OS=Arabidopsis thaliana GN=At1g11960 PE=2 SV=1 612 1048 3.0E-22
sp|Q03516|RSN1_YEAST Uncharacterized protein RSN1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RSN1 PE=1 SV=1 27 288 4.0E-22
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 612 1036 1.0E-21
sp|Q9C8G5|CSCLD_ARATH CSC1-like protein ERD4 OS=Arabidopsis thaliana GN=ERD4 PE=2 SV=1 514 978 7.0E-21
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 587 979 1.0E-20
sp|Q8VZM5|CSCL3_ARATH CSC1-like protein At4g15430 OS=Arabidopsis thaliana GN=At4g15430 PE=2 SV=1 643 979 1.0E-20
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 591 1044 1.0E-19
sp|A9LIW2|CSC1L_BRAJU CSC1-like protein ERD4 OS=Brassica juncea GN=ERD4 PE=3 SV=2 590 978 3.0E-19
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 584 979 1.0E-18
sp|F4JCY2|CSCL8_ARATH CSC1-like protein At3g54510 OS=Arabidopsis thaliana GN=At3g54510 PE=2 SV=1 647 1037 2.0E-18
sp|F4I248|CSCLB_ARATH CSC1-like protein At1g69450 OS=Arabidopsis thaliana GN=At1g69450 PE=2 SV=1 644 1025 7.0E-18
sp|Q09766|YA7D_SCHPO Uncharacterized membrane protein C24H6.13 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24H6.13 PE=1 SV=1 29 296 1.0E-16
sp|Q8GUH7|CSCLC_ARATH CSC1-like protein HYP1 OS=Arabidopsis thaliana GN=HYP1 PE=2 SV=1 603 1044 1.0E-16
sp|Q06538|CSC1_YEAST Calcium permeable stress-gated cation channel 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CSC1 PE=1 SV=1 575 1027 1.0E-12
sp|F4IBD7|CSCLA_ARATH CSC1-like protein RXW8 OS=Arabidopsis thaliana GN=RXW8 PE=2 SV=1 681 980 9.0E-12
sp|Q94A87|CSCL9_ARATH CSC1-like protein At1g10090 OS=Arabidopsis thaliana GN=At1g10090 PE=1 SV=1 681 980 4.0E-11
sp|Q12252|PHM7_YEAST Phosphate metabolism protein 7 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PHM7 PE=1 SV=1 28 307 8.0E-09
sp|Q9LVE4|CSCL4_ARATH CSC1-like protein At3g21620 OS=Arabidopsis thaliana GN=At3g21620 PE=2 SV=1 87 237 3.0E-08
sp|O43022|YGV8_SCHPO Uncharacterized protein C354.08c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC354.08c PE=3 SV=1 590 992 2.0E-07
sp|Q9XEA1|CSCL5_ARATH Protein OSCA1 OS=Arabidopsis thaliana GN=OSCA1 PE=1 SV=1 87 237 2.0E-07
sp|Q5XEZ5|CSC1_ARATH Calcium permeable stress-gated cation channel 1 OS=Arabidopsis thaliana GN=CSC1 PE=2 SV=1 19 237 8.0E-07
sp|Q9SY14|CSCL2_ARATH CSC1-like protein At4g02900 OS=Arabidopsis thaliana GN=At4g02900 PE=3 SV=1 87 237 4.0E-06
sp|F4HYR3|CSCL6_ARATH CSC1-like protein At1g62320 OS=Arabidopsis thaliana GN=At1g62320 PE=3 SV=2 89 237 6.0E-06
sp|Q07798|SPO75_YEAST Sporulation-specific protein 75 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SPO75 PE=1 SV=1 21 223 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0016020 membrane Yes
GO:0110165 cellular anatomical entity No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 19 0.5

Transmembrane Domains

Domain # Start End Length
1 25 47 22
2 108 130 22
3 184 206 22
4 702 724 22
5 756 778 22
6 791 813 22
7 859 881 22
8 913 935 22
9 961 983 22
10 996 1013 17

Transcription Factor Class

(None)

Expression data

No expression data available for this genome

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6495
MFGFLVRREDAASKAVNSQNIGITAFVTAFNTAIIVFFVQVFLFVVLRNRLARIFKPRTYLVPERERTDPPPANL
FVMLRRLVMYDDRKVINKCGLDAYFFLRYLKTLLVIFIPICCVVLPILIPINFIGGRSNQINASGNGTTNDTSSH
NVGSNNSSSSLSVTPSGLDTLAWGNVSPKHTNRYAAHLVLAILVVIWVCTVFFFELRVYIKVRQDYLTSAEHRLR
ASATTVLVNSIPEKWLTVDALVGLFDVFPGGVRNIWLNRDMTKLLDKIEQRGRVHAMLESAETNMIKAVKKAQVK
QRDAQEKRKRRQQSLKALSKKERAARNAEQDAEASRLANSGEGTNAGSQELTMDSALLSANHDVSDRVSFELETV
PEEGWKQTGSFATHGVKKSLSRVGRGFRGAASKASNDVTSSLARSHGFMTSVDQASTTRETWSSKEQEQVTHLHS
KSLDTARSHSRSPSDMSTTSHQMTVPGSNTVRQLASIDDMYVQGRTRFWQFWKPPTGAYTSPVPQGETLAETTDE
KTQEDQRSGWQRFKESLPFVGSKKEKKKKKKKKKEKLEYPPAHEPDVKADDDEGAEWAKYIKAKDRPTHRLDPFG
VHWLPGLPWFNKKVDTIYWCREELARLNLEIEEDQKHPEQFPLMKSAFIQFNHQVAAHMACQSVVHHIPRQMAPR
MNEISPRDVVWANMALSWWQAWLRTGIVVLVVAAMILLWTVPVAWSAALGQLDKLLRSLGWLGPLEHNTGAMGAL
KGLSGVLPTVFLAVALLLVPMLLRLLAGFQGAKTGAQRTEFVQIYYFVFLFVQVFLVVSVASFIGKSVTELLVKL
SQLSSASFVLDLLALNLPASANYFFSYMMLQGLSTGAATLLQVAPLFAWFILASLFDSTPRDKWLRNTRLKEVEW
DSLFPVYTNFACIGLVYCIIAPLISIFVIITFSLLWVAQRYAMLYVCRFETDTGGVLYPRAINQTFTGLYFMELC
MAGLFLIVQDEKQKRTCTTHGIVMIVVLALTVLYQVLLNKSFSPLFRYLPITFEDEAVLRDEAFQRAQDARFGGQ
REEEGARHDVSGTDGSEAKGRWRLGEHRRRHRRRDLEAQRAIGDALYGGVPDDIEDLTPDERDVLTRHAFQHYAL
RARRPTVWIPRDDVGVSDDEIRRTREYSDHIWISNEGTALDSRVGVVYGRNPPDWSEADIINL*
Coding >Ophun1|6495
ATGTTTGGCTTCCTGGTGCGTCGCGAAGATGCGGCCTCCAAGGCGGTGAATTCGCAGAACATTGGCATCACGGCC
TTTGTTACCGCCTTCAATACCGCCATCATTGTGTTTTTTGTGCAGGTCTTTCTCTTCGTGGTCCTGCGGAATAGA
CTCGCTCGAATATTTAAACCTAGAACATACCTCGTCCCTGAACGCGAACGCACCGATCCGCCTCCCGCCAATCTC
TTTGTTATGCTCCGTCGACTCGTCATGTACGACGACCGCAAGGTTATCAACAAGTGCGGTCTCGACGCCTACTTC
TTCCTCCGATACCTCAAGACGCTGCTCGTCATCTTTATCCCCATCTGCTGCGTCGTCCTGCCTATCCTCATACCT
ATCAACTTCATCGGCGGCAGGAGTAACCAGATTAACGCCTCGGGCAACGGCACCACCAACGACACCTCGTCACAC
AACGTCGGCTCCAACAATAGCAGCTCGTCTCTCAGCGTCACGCCGTCGGGTCTTGACACGCTGGCATGGGGAAAC
GTCTCACCCAAGCATACCAACCGCTATGCCGCCCACCTGGTGCTGGCCATCTTGGTCGTCATCTGGGTCTGTACC
GTCTTCTTCTTCGAGCTGCGCGTCTACATCAAGGTCCGTCAGGACTACCTCACCAGCGCCGAGCATCGCCTACGA
GCTTCGGCCACCACCGTCCTCGTCAACTCCATCCCCGAAAAATGGCTTACTGTCGATGCCCTCGTCGGACTGTTC
GACGTGTTTCCCGGCGGCGTGCGCAACATCTGGCTCAACCGAGACATGACCAAGCTGCTCGACAAGATTGAACAA
AGGGGCCGCGTTCACGCCATGCTCGAGTCTGCCGAGACCAACATGATCAAAGCGGTCAAGAAGGCGCAAGTCAAG
CAGAGAGACGCTCAAGAGAAGAGGAAGCGGCGGCAGCAGAGCCTCAAGGCACTCTCCAAAAAGGAGCGCGCCGCC
CGCAACGCCGAACAGGACGCCGAGGCGAGCCGTCTGGCCAACAGCGGCGAGGGCACCAATGCTGGCAGCCAGGAG
CTGACCATGGACTCTGCCCTCCTCTCTGCCAACCACGACGTGTCTGACAGGGTCAGCTTCGAGCTCGAGACGGTG
CCGGAAGAGGGCTGGAAGCAGACCGGCAGCTTCGCCACTCACGGCGTCAAGAAGTCTCTGTCCAGGGTCGGCAGG
GGGTTCAGGGGGGCGGCCAGCAAGGCCAGCAACGACGTAACCAGCTCGTTGGCTCGGAGCCACGGCTTCATGACT
TCGGTTGACCAGGCGTCGACGACTCGCGAGACTTGGAGTTCGAAGGAGCAGGAACAGGTTACGCATCTGCACTCG
AAATCGCTCGATACGGCCCGCTCTCACTCTCGCAGCCCGTCGGACATGTCGACGACGTCGCACCAGATGACGGTT
CCCGGTAGCAACACGGTCCGCCAGCTCGCCAGCATAGACGACATGTACGTCCAGGGACGCACCAGGTTCTGGCAG
TTTTGGAAGCCTCCGACGGGTGCCTACACGTCTCCCGTGCCGCAAGGGGAGACGTTGGCGGAGACGACGGACGAG
AAGACGCAGGAGGACCAGAGGTCTGGCTGGCAAAGGTTCAAGGAGTCGCTGCCGTTTGTGGGCTCTAAGAAGGAG
AAGAAGAAGAAAAAGAAGAAGAAGAAGGAAAAGCTGGAGTATCCTCCCGCTCACGAGCCTGACGTCAAGGCCGAC
GACGACGAGGGCGCCGAATGGGCCAAATACATCAAGGCCAAGGACAGGCCCACGCACCGGCTGGACCCCTTTGGC
GTGCACTGGCTGCCGGGCCTCCCCTGGTTCAACAAAAAGGTCGACACCATCTACTGGTGCCGAGAGGAGCTGGCG
CGGCTCAACCTGGAGATTGAAGAGGACCAGAAGCACCCGGAGCAGTTCCCGCTGATGAAGTCGGCCTTTATCCAG
TTCAACCACCAGGTGGCGGCTCACATGGCCTGTCAGAGCGTGGTGCATCACATCCCGCGACAGATGGCGCCGCGC
ATGAACGAAATCTCTCCGCGCGACGTCGTCTGGGCCAACATGGCGCTGAGCTGGTGGCAGGCCTGGCTGCGGACC
GGCATCGTCGTCTTGGTCGTCGCGGCCATGATCTTGCTCTGGACGGTTCCCGTGGCCTGGTCGGCGGCGCTGGGC
CAGTTGGACAAGCTGCTGCGGTCGCTGGGATGGCTGGGTCCGCTCGAGCATAACACGGGGGCCATGGGCGCCCTC
AAGGGCCTTTCCGGCGTGTTGCCCACCGTCTTCCTGGCCGTGGCGCTGCTGCTGGTGCCCATGCTGCTGAGGCTG
CTGGCGGGCTTCCAGGGGGCCAAGACGGGGGCTCAGCGGACCGAGTTTGTGCAGATTTACTACTTTGTGTTTCTG
TTCGTGCAGGTTTTCCTGGTCGTCTCGGTGGCGTCGTTTATCGGCAAGTCGGTGACGGAACTGCTGGTCAAGCTG
TCGCAACTATCGTCGGCGTCGTTTGTGCTGGATCTGCTGGCGCTCAACCTGCCGGCCTCGGCAAACTACTTCTTC
TCCTACATGATGCTACAGGGACTGTCGACGGGCGCGGCCACGCTGCTGCAGGTGGCCCCCCTGTTTGCCTGGTTC
ATCCTGGCGTCTCTCTTCGACAGCACGCCGCGAGACAAGTGGCTGCGCAACACGCGGCTCAAGGAGGTCGAGTGG
GACAGCCTGTTTCCCGTCTATACCAACTTTGCCTGCATCGGGCTCGTCTACTGCATCATCGCGCCCCTCATCAGC
ATCTTCGTCATCATCACCTTTAGCCTGCTGTGGGTGGCGCAGCGGTACGCCATGCTCTACGTGTGCCGCTTCGAG
ACGGACACGGGCGGCGTGCTGTACCCGCGGGCCATCAACCAGACCTTTACGGGCCTCTACTTTATGGAGCTGTGT
ATGGCCGGCCTGTTCCTGATAGTGCAGGACGAGAAGCAGAAGCGGACCTGCACGACTCACGGCATCGTCATGATT
GTCGTCCTGGCGCTGACGGTGCTGTATCAGGTGCTGCTCAACAAGTCCTTCTCGCCCCTGTTCCGCTATCTGCCC
ATCACGTTTGAGGACGAGGCGGTGCTGCGGGACGAGGCCTTTCAGCGCGCGCAGGACGCCCGGTTCGGCGGACAG
CGCGAGGAAGAGGGAGCTCGGCACGACGTGTCCGGGACCGACGGGTCGGAAGCCAAGGGCCGGTGGCGGCTCGGC
GAGCACCGGCGGCGACACCGGCGTCGGGACCTCGAGGCTCAGCGCGCCATAGGAGACGCGCTGTACGGGGGGGTC
CCGGACGATATCGAGGACCTGACGCCGGACGAGAGGGACGTGTTGACGCGGCACGCGTTCCAGCATTACGCGCTG
AGGGCGCGACGGCCGACGGTCTGGATCCCGCGCGACGACGTGGGTGTCAGCGACGATGAGATCCGGCGGACGAGA
GAGTATAGCGATCACATCTGGATAAGCAACGAGGGGACGGCGCTGGATAGCAGGGTGGGAGTCGTCTACGGCCGG
AACCCGCCTGACTGGTCTGAGGCGGACATTATTAACCTGTGA
Transcript >Ophun1|6495
ATGTTTGGCTTCCTGGTGCGTCGCGAAGATGCGGCCTCCAAGGCGGTGAATTCGCAGAACATTGGCATCACGGCC
TTTGTTACCGCCTTCAATACCGCCATCATTGTGTTTTTTGTGCAGGTCTTTCTCTTCGTGGTCCTGCGGAATAGA
CTCGCTCGAATATTTAAACCTAGAACATACCTCGTCCCTGAACGCGAACGCACCGATCCGCCTCCCGCCAATCTC
TTTGTTATGCTCCGTCGACTCGTCATGTACGACGACCGCAAGGTTATCAACAAGTGCGGTCTCGACGCCTACTTC
TTCCTCCGATACCTCAAGACGCTGCTCGTCATCTTTATCCCCATCTGCTGCGTCGTCCTGCCTATCCTCATACCT
ATCAACTTCATCGGCGGCAGGAGTAACCAGATTAACGCCTCGGGCAACGGCACCACCAACGACACCTCGTCACAC
AACGTCGGCTCCAACAATAGCAGCTCGTCTCTCAGCGTCACGCCGTCGGGTCTTGACACGCTGGCATGGGGAAAC
GTCTCACCCAAGCATACCAACCGCTATGCCGCCCACCTGGTGCTGGCCATCTTGGTCGTCATCTGGGTCTGTACC
GTCTTCTTCTTCGAGCTGCGCGTCTACATCAAGGTCCGTCAGGACTACCTCACCAGCGCCGAGCATCGCCTACGA
GCTTCGGCCACCACCGTCCTCGTCAACTCCATCCCCGAAAAATGGCTTACTGTCGATGCCCTCGTCGGACTGTTC
GACGTGTTTCCCGGCGGCGTGCGCAACATCTGGCTCAACCGAGACATGACCAAGCTGCTCGACAAGATTGAACAA
AGGGGCCGCGTTCACGCCATGCTCGAGTCTGCCGAGACCAACATGATCAAAGCGGTCAAGAAGGCGCAAGTCAAG
CAGAGAGACGCTCAAGAGAAGAGGAAGCGGCGGCAGCAGAGCCTCAAGGCACTCTCCAAAAAGGAGCGCGCCGCC
CGCAACGCCGAACAGGACGCCGAGGCGAGCCGTCTGGCCAACAGCGGCGAGGGCACCAATGCTGGCAGCCAGGAG
CTGACCATGGACTCTGCCCTCCTCTCTGCCAACCACGACGTGTCTGACAGGGTCAGCTTCGAGCTCGAGACGGTG
CCGGAAGAGGGCTGGAAGCAGACCGGCAGCTTCGCCACTCACGGCGTCAAGAAGTCTCTGTCCAGGGTCGGCAGG
GGGTTCAGGGGGGCGGCCAGCAAGGCCAGCAACGACGTAACCAGCTCGTTGGCTCGGAGCCACGGCTTCATGACT
TCGGTTGACCAGGCGTCGACGACTCGCGAGACTTGGAGTTCGAAGGAGCAGGAACAGGTTACGCATCTGCACTCG
AAATCGCTCGATACGGCCCGCTCTCACTCTCGCAGCCCGTCGGACATGTCGACGACGTCGCACCAGATGACGGTT
CCCGGTAGCAACACGGTCCGCCAGCTCGCCAGCATAGACGACATGTACGTCCAGGGACGCACCAGGTTCTGGCAG
TTTTGGAAGCCTCCGACGGGTGCCTACACGTCTCCCGTGCCGCAAGGGGAGACGTTGGCGGAGACGACGGACGAG
AAGACGCAGGAGGACCAGAGGTCTGGCTGGCAAAGGTTCAAGGAGTCGCTGCCGTTTGTGGGCTCTAAGAAGGAG
AAGAAGAAGAAAAAGAAGAAGAAGAAGGAAAAGCTGGAGTATCCTCCCGCTCACGAGCCTGACGTCAAGGCCGAC
GACGACGAGGGCGCCGAATGGGCCAAATACATCAAGGCCAAGGACAGGCCCACGCACCGGCTGGACCCCTTTGGC
GTGCACTGGCTGCCGGGCCTCCCCTGGTTCAACAAAAAGGTCGACACCATCTACTGGTGCCGAGAGGAGCTGGCG
CGGCTCAACCTGGAGATTGAAGAGGACCAGAAGCACCCGGAGCAGTTCCCGCTGATGAAGTCGGCCTTTATCCAG
TTCAACCACCAGGTGGCGGCTCACATGGCCTGTCAGAGCGTGGTGCATCACATCCCGCGACAGATGGCGCCGCGC
ATGAACGAAATCTCTCCGCGCGACGTCGTCTGGGCCAACATGGCGCTGAGCTGGTGGCAGGCCTGGCTGCGGACC
GGCATCGTCGTCTTGGTCGTCGCGGCCATGATCTTGCTCTGGACGGTTCCCGTGGCCTGGTCGGCGGCGCTGGGC
CAGTTGGACAAGCTGCTGCGGTCGCTGGGATGGCTGGGTCCGCTCGAGCATAACACGGGGGCCATGGGCGCCCTC
AAGGGCCTTTCCGGCGTGTTGCCCACCGTCTTCCTGGCCGTGGCGCTGCTGCTGGTGCCCATGCTGCTGAGGCTG
CTGGCGGGCTTCCAGGGGGCCAAGACGGGGGCTCAGCGGACCGAGTTTGTGCAGATTTACTACTTTGTGTTTCTG
TTCGTGCAGGTTTTCCTGGTCGTCTCGGTGGCGTCGTTTATCGGCAAGTCGGTGACGGAACTGCTGGTCAAGCTG
TCGCAACTATCGTCGGCGTCGTTTGTGCTGGATCTGCTGGCGCTCAACCTGCCGGCCTCGGCAAACTACTTCTTC
TCCTACATGATGCTACAGGGACTGTCGACGGGCGCGGCCACGCTGCTGCAGGTGGCCCCCCTGTTTGCCTGGTTC
ATCCTGGCGTCTCTCTTCGACAGCACGCCGCGAGACAAGTGGCTGCGCAACACGCGGCTCAAGGAGGTCGAGTGG
GACAGCCTGTTTCCCGTCTATACCAACTTTGCCTGCATCGGGCTCGTCTACTGCATCATCGCGCCCCTCATCAGC
ATCTTCGTCATCATCACCTTTAGCCTGCTGTGGGTGGCGCAGCGGTACGCCATGCTCTACGTGTGCCGCTTCGAG
ACGGACACGGGCGGCGTGCTGTACCCGCGGGCCATCAACCAGACCTTTACGGGCCTCTACTTTATGGAGCTGTGT
ATGGCCGGCCTGTTCCTGATAGTGCAGGACGAGAAGCAGAAGCGGACCTGCACGACTCACGGCATCGTCATGATT
GTCGTCCTGGCGCTGACGGTGCTGTATCAGGTGCTGCTCAACAAGTCCTTCTCGCCCCTGTTCCGCTATCTGCCC
ATCACGTTTGAGGACGAGGCGGTGCTGCGGGACGAGGCCTTTCAGCGCGCGCAGGACGCCCGGTTCGGCGGACAG
CGCGAGGAAGAGGGAGCTCGGCACGACGTGTCCGGGACCGACGGGTCGGAAGCCAAGGGCCGGTGGCGGCTCGGC
GAGCACCGGCGGCGACACCGGCGTCGGGACCTCGAGGCTCAGCGCGCCATAGGAGACGCGCTGTACGGGGGGGTC
CCGGACGATATCGAGGACCTGACGCCGGACGAGAGGGACGTGTTGACGCGGCACGCGTTCCAGCATTACGCGCTG
AGGGCGCGACGGCCGACGGTCTGGATCCCGCGCGACGACGTGGGTGTCAGCGACGATGAGATCCGGCGGACGAGA
GAGTATAGCGATCACATCTGGATAAGCAACGAGGGGACGGCGCTGGATAGCAGGGTGGGAGTCGTCTACGGCCGG
AACCCGCCTGACTGGTCTGAGGCGGACATTATTAACCTGTGA
Gene >Ophun1|6495
ATGTTTGGCTTCCTGGTGCGTCGCGAAGATGCGGCCTCCAAGGCGGTGAATTCGCAGAACATTGGCATCACGGCC
TTTGTTACCGCCTTCAATACCGCCATCATTGTGTTTTTTGTGCAGGTCTTTCTCTTCGTGGTCCTGCGGAATAGA
CTCGCTCGAATATTGTACGTTGATGCTGCTGCTGCTCTTCTACCCGTCTGCTTCCGACGCTCACCTCCCGCTGCA
GTAAACCTAGAACATACCTCGTCCCTGAACGCGAACGCACCGATCCGCCTCCCGCCAATCTCTTTGTTATGCTCC
GTCGACTCGTCATGTACGACGACCGCAAGGTTATCAACAAGTGCGGTCTCGACGCCTACTTCTTCCTCCGATACC
TCAAGACGCTGCTCGTCATCTTTATCCCCATCTGCTGCGTCGTCCTGCCTATCCTCATACCTATCAACTTCATCG
GCGGCAGGAGTAACCAGATTAACGCCTCGGGCAACGGCACCACCAACGACACCTCGTCACACAACGTCGGCTCCA
ACAATAGCAGCTCGTCTCTCAGCGTCACGCCGTCGGGTCTTGACACGCTGGCATGGGGAAACGTCTCACCCAAGC
ATACCAACCGCTATGCCGCCCACCTGGTGCTGGCCATCTTGGTCGTCATCTGGGTCTGTACCGTCTTCTTCTTCG
AGCTGCGCGTCTACATCAAGGTCCGTCAGGACTACCTCACCAGCGCCGAGCATCGCCTACGAGCTTCGGCCACCA
CCGTCCTCGTCAACTCCATCCCCGAAAAATGGCTTACTGTCGATGCCCTCGTCGGACTGTTCGACGTGTTTCCCG
GCGGCGTGCGCAACATCTGGCTCAACCGAGACATGACCAAGCTGCTCGACAAGATTGAACAAAGGGGCCGCGTTC
ACGCCATGCTCGAGTCTGCCGAGACCAACATGATCAAAGCGGTCAAGAAGGCGCAAGTCAAGCAGAGAGACGCTC
AAGAGAAGAGGAAGCGGCGGCAGCAGAGCCTCAAGGCACTCTCCAAAAAGGAGCGCGCCGCCCGCAACGCCGAAC
AGGACGCCGAGGCGAGCCGTCTGGCCAACAGCGGCGAGGGCACCAATGCTGGCAGCCAGGAGCTGACCATGGACT
CTGCCCTCCTCTCTGCCAACCACGACGTGTCTGACAGGGTCAGCTTCGAGCTCGAGACGGTGCCGGAAGAGGGCT
GGAAGCAGACCGGCAGCTTCGCCACTCACGGCGTCAAGAAGTCTCTGTCCAGGGTCGGCAGGGGGTTCAGGGGGG
CGGCCAGCAAGGCCAGCAACGACGTAACCAGCTCGTTGGCTCGGAGCCACGGCTTCATGACTTCGGTTGACCAGG
CGTCGACGACTCGCGAGACTTGGAGTTCGAAGGAGCAGGAACAGGTTACGCATCTGCACTCGAAATCGCTCGATA
CGGCCCGCTCTCACTCTCGCAGCCCGTCGGACATGTCGACGACGTCGCACCAGATGACGGTTCCCGGTAGCAACA
CGGTCCGCCAGCTCGCCAGCATAGACGACATGTACGTCCAGGGACGCACCAGGTTCTGGCAGTTTTGGAAGCCTC
CGACGGGTGCCTACACGTCTCCCGTGCCGCAAGGGGAGACGTTGGCGGAGACGACGGACGAGAAGACGCAGGAGG
ACCAGAGGTCTGGCTGGCAAAGGTTCAAGGAGTCGCTGCCGTTTGTGGGCTCTAAGAAGGAGAAGAAGAAGAAAA
AGAAGAAGAAGAAGGAAAAGCTGGAGTATCCTCCCGCTCACGAGCCTGACGTCAAGGCCGACGACGACGAGGGCG
CCGAATGGGCCAAATACATCAAGGCCAAGGACAGGCCCACGCACCGGCTGGACCCCTTTGGCGTGCACTGGCTGC
CGGGCCTCCCCTGGTTCAACAAAAAGGTCGACACCATCTACTGGTGCCGAGAGGAGCTGGCGCGGCTCAACCTGG
AGATTGAAGAGGACCAGAAGCACCCGGAGCAGTTCCCGCTGATGAAGTCGGCCTTTATCCAGTTCAACCACCAGG
TGGCGGCTCACATGGCCTGTCAGAGCGTGGTGCATCACATCCCGCGACAGATGGCGCCGCGCATGAACGAAATCT
CTCCGCGCGACGTCGTCTGGGCCAACATGGCGCTGAGCTGGTGGCAGGCCTGGCTGCGGACCGGCATCGTCGTCT
TGGTCGTCGCGGCCATGATCTTGCTCTGGACGGTTCCCGTGGCCTGGTCGGCGGCGCTGGGCCAGTTGGACAAGC
TGCTGCGGTCGCTGGGATGGCTGGGTCCGCTCGAGCATAACACGGGGGCCATGGGCGCCCTCAAGGGCCTTTCCG
GCGTGTTGCCCACCGTCTTCCTGGCCGTGGCGCTGCTGCTGGTGCCCATGCTGCTGAGGCTGCTGGCGGGCTTCC
AGGGGGCCAAGACGGGGGCTCAGCGGACCGAGTTTGTGCAGATTTACTACTTTGTGTTTCTGTTCGTGCAGGTTT
TCCTGGTCGTCTCGGTGGCGTCGTTTATCGGCAAGTCGGTGACGGAACTGCTGGTCAAGCTGTCGCAACTATCGT
CGGCGTCGTTTGTGCTGGATCTGCTGGCGCTCAACCTGCCGGCCTCGGCAAACTACTTCTTCTCCTACATGATGC
TACAGGGACTGTCGACGGGCGCGGCCACGCTGCTGCAGGTGGCCCCCCTGTTTGCCTGGTTCATCCTGGCGTCTC
TCTTCGACAGCACGCCGCGAGACAAGTGGCTGCGCAACACGCGGCTCAAGGAGGTCGAGTGGGACAGCCTGTTTC
CCGTCTATACCAACTTTGCCTGCATCGGGCTCGTCTACTGCATCATCGCGCCCCTCATCAGCATCTTCGTCATCA
TCACCTTTAGCCTGCTGTGGGTGGCGCAGCGGTACGCCATGCTCTACGTGTGCCGCTTCGAGACGGACACGGGCG
GCGTGCTGTACCCGCGGGCCATCAACCAGACCTTTACGGGCCTCTACTTTATGGAGCTGTGTATGGCCGGCCTGT
TCCTGATAGTGCAGGACGAGAAGCAGAAGCGGACCTGCACGACTCACGGCATCGTCATGATTGTCGTCCTGGCGC
TGACGGTGCTGTATCAGGTGCTGCTCAACAAGTCCTTCTCGCCCCTGTTCCGCTATCTGCCCATCACGTTTGAGG
ACGAGGCGGTGCTGCGGGACGAGGCCTTTCAGCGCGCGCAGGACGCCCGGTTCGGCGGACAGCGCGAGGAAGAGG
GAGCTCGGCACGACGTGTCCGGGACCGACGGGTCGGAAGCCAAGGGCCGGTGGCGGCTCGGCGAGCACCGGCGGC
GACACCGGCGTCGGGACCTCGAGGCTCAGCGCGCCATAGGAGACGCGCTGTACGGGGGGGTCCCGGACGATATCG
AGGACCTGACGCCGGACGAGAGGGACGTGTTGACGCGGCACGCGTTCCAGCATTACGCGCTGAGGGCGCGACGGC
CGACGGTCTGGATCCCGCGCGACGACGTGGGTGTCAGCGACGATGAGATCCGGCGGACGAGAGAGTATAGCGATC
ACATCTGGATAAGCAACGAGGGGACGGCGCTGGATAGCAGGGTGGGAGTCGTCTACGGCCGGAACCCGCCTGACT
GGTCTGAGGCGGACATTATTAACCTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail