Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|649
Gene name
LocationContig_120:13038..14120
Strand+
Gene length (bp)1082
Transcript length (bp)1020
Coding sequence length (bp)1020
Protein length (aa) 340

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13668 Ferritin_2 Ferritin-like domain 2.5E-31 40 182

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 17 0.982171

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup385
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|4782
Ophiocordyceps australis map64 (Brazil) OphauB2|7753
Ophiocordyceps camponoti-floridani Ophcf2|00353
Ophiocordyceps camponoti-floridani Ophcf2|05839
Ophiocordyceps camponoti-rufipedis Ophun1|649 (this protein)
Ophiocordyceps kimflemingae Ophio5|5819
Ophiocordyceps kimflemingae Ophio5|8137
Ophiocordyceps subramaniannii Hirsu2|1323
Ophiocordyceps subramaniannii Hirsu2|5078

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|649
MVSFTTSLTALVLAAAACARPTPVTLKPRQAAAPGDANMDVLVAKFALTLEELESAFYREAISKNSQPLSNNLLR
RAKTVQTRSLNDKQIALMEKIFQTEDAHATALQQALSAAGGPVLRPCKYKFDTSSAATILQTATLLEEVGQAAYQ
GAAPLLQDKALLAKAASILTVEAQHSTVLRVLGGRDPVPRAFTNSLNPPEVSTLIEGFIESCEDASNPLKLVPPN
PQLQLQPSAGPPPNGNNNPLNQAGVQAATFLRFAIASGGEAAVARQATGAALPSINEAKFCVFPGGSPDQTRFVD
YSEPQGCQRPDDLVLPGLVMLARERDVGTVIAGPVPILN*
Coding >Ophun1|649
ATGGTTTCCTTTACGACTTCCCTCACGGCTTTGGTCTTGGCTGCGGCGGCGTGTGCTCGGCCTACGCCTGTCACC
TTGAAGCCTCGACAGGCGGCGGCACCGGGAGATGCGAACATGGATGTCTTGGTGGCGAAATTCGCCCTCACTCTG
GAAGAATTAGAATCGGCATTCTACAGAGAAGCCATCAGCAAGAACTCGCAACCGCTCTCCAACAACTTGCTAAGA
CGCGCCAAGACTGTGCAAACGCGCTCCCTCAACGACAAGCAAATCGCCCTGATGGAGAAGATATTCCAAACCGAA
GACGCCCACGCAACCGCCCTCCAACAAGCCCTCTCCGCAGCAGGCGGGCCCGTCCTCCGCCCCTGCAAGTACAAG
TTCGACACCAGCAGCGCAGCCACCATCCTGCAGACGGCCACCCTGCTGGAAGAGGTCGGGCAGGCAGCCTACCAG
GGCGCGGCGCCGCTGCTGCAGGACAAGGCCCTGCTGGCCAAGGCGGCGTCCATCTTGACGGTCGAGGCGCAGCAT
TCGACCGTGTTGCGCGTGTTGGGGGGCAGGGATCCGGTTCCGAGGGCGTTTACCAACTCGCTCAACCCCCCCGAG
GTGTCGACGCTGATCGAGGGCTTCATCGAGAGCTGTGAGGATGCATCCAATCCTCTGAAGCTGGTGCCTCCCAAC
CCGCAACTCCAACTCCAGCCCTCAGCCGGCCCCCCCCCCAACGGCAACAACAACCCCCTCAACCAAGCCGGCGTC
CAGGCCGCAACCTTTTTGCGCTTCGCCATCGCCAGCGGCGGCGAGGCAGCCGTCGCGAGACAGGCAACGGGCGCA
GCCCTCCCCTCCATCAACGAGGCGAAGTTCTGCGTGTTCCCCGGTGGCTCGCCAGATCAGACGCGGTTCGTGGAT
TATTCGGAGCCGCAGGGGTGTCAGCGGCCGGATGATTTGGTGTTGCCTGGGCTTGTCATGTTGGCGAGGGAGAGG
GATGTTGGGACGGTTATTGCGGGGCCGGTTCCCATTCTCAATTGA
Transcript >Ophun1|649
ATGGTTTCCTTTACGACTTCCCTCACGGCTTTGGTCTTGGCTGCGGCGGCGTGTGCTCGGCCTACGCCTGTCACC
TTGAAGCCTCGACAGGCGGCGGCACCGGGAGATGCGAACATGGATGTCTTGGTGGCGAAATTCGCCCTCACTCTG
GAAGAATTAGAATCGGCATTCTACAGAGAAGCCATCAGCAAGAACTCGCAACCGCTCTCCAACAACTTGCTAAGA
CGCGCCAAGACTGTGCAAACGCGCTCCCTCAACGACAAGCAAATCGCCCTGATGGAGAAGATATTCCAAACCGAA
GACGCCCACGCAACCGCCCTCCAACAAGCCCTCTCCGCAGCAGGCGGGCCCGTCCTCCGCCCCTGCAAGTACAAG
TTCGACACCAGCAGCGCAGCCACCATCCTGCAGACGGCCACCCTGCTGGAAGAGGTCGGGCAGGCAGCCTACCAG
GGCGCGGCGCCGCTGCTGCAGGACAAGGCCCTGCTGGCCAAGGCGGCGTCCATCTTGACGGTCGAGGCGCAGCAT
TCGACCGTGTTGCGCGTGTTGGGGGGCAGGGATCCGGTTCCGAGGGCGTTTACCAACTCGCTCAACCCCCCCGAG
GTGTCGACGCTGATCGAGGGCTTCATCGAGAGCTGTGAGGATGCATCCAATCCTCTGAAGCTGGTGCCTCCCAAC
CCGCAACTCCAACTCCAGCCCTCAGCCGGCCCCCCCCCCAACGGCAACAACAACCCCCTCAACCAAGCCGGCGTC
CAGGCCGCAACCTTTTTGCGCTTCGCCATCGCCAGCGGCGGCGAGGCAGCCGTCGCGAGACAGGCAACGGGCGCA
GCCCTCCCCTCCATCAACGAGGCGAAGTTCTGCGTGTTCCCCGGTGGCTCGCCAGATCAGACGCGGTTCGTGGAT
TATTCGGAGCCGCAGGGGTGTCAGCGGCCGGATGATTTGGTGTTGCCTGGGCTTGTCATGTTGGCGAGGGAGAGG
GATGTTGGGACGGTTATTGCGGGGCCGGTTCCCATTCTCAATTGA
Gene >Ophun1|649
ATGGTTTCCTTTACGACTTCCCTCACGGCTTTGGTCTTGGCTGCGGCGGCGTGTGCTCGGCCTACGCCTGTCACC
TTGAAGCCTCGACAGGCGGCGGCACCGGGAGATGCGAACATGGATGTCTTGGTGGCGAAATTGTGAGTTTTGAGA
TGAAGATGCGGGATGAGGGAACGAGGGGGGAAAGCTAACGTTGTTGCAGCGCCCTCACTCTGGAAGAATTAGAAT
CGGCATTCTACAGAGAAGCCATCAGCAAGAACTCGCAACCGCTCTCCAACAACTTGCTAAGACGCGCCAAGACTG
TGCAAACGCGCTCCCTCAACGACAAGCAAATCGCCCTGATGGAGAAGATATTCCAAACCGAAGACGCCCACGCAA
CCGCCCTCCAACAAGCCCTCTCCGCAGCAGGCGGGCCCGTCCTCCGCCCCTGCAAGTACAAGTTCGACACCAGCA
GCGCAGCCACCATCCTGCAGACGGCCACCCTGCTGGAAGAGGTCGGGCAGGCAGCCTACCAGGGCGCGGCGCCGC
TGCTGCAGGACAAGGCCCTGCTGGCCAAGGCGGCGTCCATCTTGACGGTCGAGGCGCAGCATTCGACCGTGTTGC
GCGTGTTGGGGGGCAGGGATCCGGTTCCGAGGGCGTTTACCAACTCGCTCAACCCCCCCGAGGTGTCGACGCTGA
TCGAGGGCTTCATCGAGAGCTGTGAGGATGCATCCAATCCTCTGAAGCTGGTGCCTCCCAACCCGCAACTCCAAC
TCCAGCCCTCAGCCGGCCCCCCCCCCAACGGCAACAACAACCCCCTCAACCAAGCCGGCGTCCAGGCCGCAACCT
TTTTGCGCTTCGCCATCGCCAGCGGCGGCGAGGCAGCCGTCGCGAGACAGGCAACGGGCGCAGCCCTCCCCTCCA
TCAACGAGGCGAAGTTCTGCGTGTTCCCCGGTGGCTCGCCAGATCAGACGCGGTTCGTGGATTATTCGGAGCCGC
AGGGGTGTCAGCGGCCGGATGATTTGGTGTTGCCTGGGCTTGTCATGTTGGCGAGGGAGAGGGATGTTGGGACGG
TTATTGCGGGGCCGGTTCCCATTCTCAATTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail