Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6485
Gene name
LocationContig_71:18425..19991
Strand+
Gene length (bp)1566
Transcript length (bp)1566
Coding sequence length (bp)1566
Protein length (aa) 522

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01476 LysM LysM domain 5.2E-06 34 78
PF01476 LysM LysM domain 1.2E-05 97 139
PF01476 LysM LysM domain 8.8E-06 152 196

Swissprot hits

(None)

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

SignalP signal predicted Location Score
Yes 1 - 20 0.999656

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup229
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis map64 (Brazil) OphauB2|4895
Ophiocordyceps camponoti-floridani Ophcf2|01392
Ophiocordyceps camponoti-floridani Ophcf2|02584
Ophiocordyceps camponoti-floridani Ophcf2|03908
Ophiocordyceps camponoti-rufipedis Ophun1|4148
Ophiocordyceps camponoti-rufipedis Ophun1|6485 (this protein)
Ophiocordyceps kimflemingae Ophio5|2669
Ophiocordyceps kimflemingae Ophio5|5651
Ophiocordyceps kimflemingae Ophio5|5719
Ophiocordyceps subramaniannii Hirsu2|3699
Ophiocordyceps subramaniannii Hirsu2|6751

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6485
MASPLSRLLLLGGYSALAAAGVPQPLPSEKLCQHRVKSGEFCYLIAENYKTTVPDLRKWNPQLDDACSLNPKDIL
NVPCVEPEKPMPKMDGPCTKFYTAAEGDTCYSIATCQAVAPQNLIAWNQLDEACTLEAGRELCVSHYEEPAECNK
YHRVKKGDTCFDIAQSIGKDLSYLVELNPALLQPVCSLDVGYKVCIEAASESVIDDATFTSLIDALTSAAEVSGS
STSTCTSAVLVDASSTAAVVSVASVDASTSSTSVSVVSSEVSSKASTPSTAVIFTAPASVSAVSSEASTASTDAS
APSTAVSTTPALVTSVSQPLWPLNRTTTTIVTTFITKSLTRSPSLPSSLSLPSSSPRPPVTLNVNISQELKARLR
LICGRYVGNYTKPEPIPDSVLLPPSSQIEEMVKEAAKVKSEGLQVPGGNAVEAVVPSSGPQTIVLNQLFRIIVSA
SVDIRSSGCDTGACSLQVSYSANAGIRAPAAVGSELELPQSDAPAAASDETEEVGEDETEEDDEEGSCGAI*
Coding >Ophun1|6485
ATGGCCTCCCCCCTAAGCCGCCTCCTCCTCCTCGGCGGCTATTCAGCCCTCGCCGCCGCCGGCGTGCCCCAACCG
CTCCCAAGCGAGAAGCTATGCCAGCACAGAGTCAAGAGCGGAGAATTCTGCTACCTCATCGCAGAAAACTACAAG
ACAACCGTCCCAGATCTCCGCAAATGGAACCCTCAGCTCGACGACGCCTGCAGCCTCAACCCCAAAGACATTCTC
AACGTCCCCTGCGTCGAGCCAGAGAAGCCAATGCCCAAGATGGACGGCCCTTGCACCAAGTTCTACACTGCTGCT
GAGGGAGACACCTGCTACTCCATCGCCACCTGCCAGGCGGTTGCGCCCCAGAACCTCATTGCTTGGAACCAGCTT
GATGAGGCTTGCACTCTCGAGGCGGGGCGGGAGTTGTGCGTCTCTCACTATGAGGAGCCTGCTGAGTGCAACAAG
TATCACCGCGTCAAGAAGGGAGATACGTGCTTTGATATTGCGCAGAGCATTGGCAAGGATTTGTCTTACTTGGTT
GAGCTGAACCCGGCGTTGCTGCAGCCGGTTTGCTCGCTTGATGTCGGTTACAAGGTCTGCATTGAGGCCGCGTCT
GAGTCGGTCATCGATGATGCTACTTTCACATCTCTGATCGATGCTCTTACTTCTGCGGCCGAAGTCTCTGGCTCT
TCGACCAGTACATGCACTTCCGCTGTCTTAGTCGATGCATCTTCAACTGCGGCTGTCGTCTCTGTTGCTTCAGTC
GATGCCTCTACTTCTTCGACTTCCGTCTCTGTTGTTTCCTCTGAGGTTTCCTCCAAGGCTTCAACTCCCTCGACC
GCCGTCATCTTCACCGCCCCGGCTTCCGTTTCCGCTGTTTCCTCCGAGGCTTCTACTGCCTCAACTGATGCTTCA
GCTCCCTCAACCGCCGTCTCAACCACCCCGGCCCTCGTCACATCCGTCTCGCAGCCTCTCTGGCCTCTGAACAGA
ACAACCACCACCATCGTCACAACCTTCATCACCAAGTCTCTCACCCGCTCGCCGTCTCTTCCCAGCTCGCTCTCC
CTTCCCAGCTCCTCGCCCCGCCCCCCCGTTACCCTGAACGTCAATATCTCGCAAGAGCTCAAGGCTCGCCTCAGG
CTGATCTGCGGCCGCTACGTCGGCAACTACACCAAGCCCGAGCCCATCCCGGACTCGGTCCTCTTGCCGCCCAGC
TCTCAGATAGAGGAAATGGTCAAGGAAGCGGCCAAGGTCAAGTCTGAGGGCCTTCAGGTTCCTGGTGGCAATGCG
GTGGAAGCCGTTGTCCCTTCGTCTGGTCCTCAGACTATCGTTCTGAACCAGCTGTTCAGAATCATCGTCTCTGCC
TCGGTTGACATTCGGAGCAGCGGCTGCGATACCGGTGCTTGCTCCCTTCAAGTCTCCTACAGCGCCAACGCCGGC
ATCAGGGCTCCGGCTGCAGTGGGCTCCGAGCTGGAGTTACCGCAGAGTGACGCCCCGGCCGCAGCTTCTGACGAG
ACCGAGGAGGTTGGGGAGGATGAGACGGAGGAAGATGACGAGGAGGGAAGCTGTGGGGCTATCTAG
Transcript >Ophun1|6485
ATGGCCTCCCCCCTAAGCCGCCTCCTCCTCCTCGGCGGCTATTCAGCCCTCGCCGCCGCCGGCGTGCCCCAACCG
CTCCCAAGCGAGAAGCTATGCCAGCACAGAGTCAAGAGCGGAGAATTCTGCTACCTCATCGCAGAAAACTACAAG
ACAACCGTCCCAGATCTCCGCAAATGGAACCCTCAGCTCGACGACGCCTGCAGCCTCAACCCCAAAGACATTCTC
AACGTCCCCTGCGTCGAGCCAGAGAAGCCAATGCCCAAGATGGACGGCCCTTGCACCAAGTTCTACACTGCTGCT
GAGGGAGACACCTGCTACTCCATCGCCACCTGCCAGGCGGTTGCGCCCCAGAACCTCATTGCTTGGAACCAGCTT
GATGAGGCTTGCACTCTCGAGGCGGGGCGGGAGTTGTGCGTCTCTCACTATGAGGAGCCTGCTGAGTGCAACAAG
TATCACCGCGTCAAGAAGGGAGATACGTGCTTTGATATTGCGCAGAGCATTGGCAAGGATTTGTCTTACTTGGTT
GAGCTGAACCCGGCGTTGCTGCAGCCGGTTTGCTCGCTTGATGTCGGTTACAAGGTCTGCATTGAGGCCGCGTCT
GAGTCGGTCATCGATGATGCTACTTTCACATCTCTGATCGATGCTCTTACTTCTGCGGCCGAAGTCTCTGGCTCT
TCGACCAGTACATGCACTTCCGCTGTCTTAGTCGATGCATCTTCAACTGCGGCTGTCGTCTCTGTTGCTTCAGTC
GATGCCTCTACTTCTTCGACTTCCGTCTCTGTTGTTTCCTCTGAGGTTTCCTCCAAGGCTTCAACTCCCTCGACC
GCCGTCATCTTCACCGCCCCGGCTTCCGTTTCCGCTGTTTCCTCCGAGGCTTCTACTGCCTCAACTGATGCTTCA
GCTCCCTCAACCGCCGTCTCAACCACCCCGGCCCTCGTCACATCCGTCTCGCAGCCTCTCTGGCCTCTGAACAGA
ACAACCACCACCATCGTCACAACCTTCATCACCAAGTCTCTCACCCGCTCGCCGTCTCTTCCCAGCTCGCTCTCC
CTTCCCAGCTCCTCGCCCCGCCCCCCCGTTACCCTGAACGTCAATATCTCGCAAGAGCTCAAGGCTCGCCTCAGG
CTGATCTGCGGCCGCTACGTCGGCAACTACACCAAGCCCGAGCCCATCCCGGACTCGGTCCTCTTGCCGCCCAGC
TCTCAGATAGAGGAAATGGTCAAGGAAGCGGCCAAGGTCAAGTCTGAGGGCCTTCAGGTTCCTGGTGGCAATGCG
GTGGAAGCCGTTGTCCCTTCGTCTGGTCCTCAGACTATCGTTCTGAACCAGCTGTTCAGAATCATCGTCTCTGCC
TCGGTTGACATTCGGAGCAGCGGCTGCGATACCGGTGCTTGCTCCCTTCAAGTCTCCTACAGCGCCAACGCCGGC
ATCAGGGCTCCGGCTGCAGTGGGCTCCGAGCTGGAGTTACCGCAGAGTGACGCCCCGGCCGCAGCTTCTGACGAG
ACCGAGGAGGTTGGGGAGGATGAGACGGAGGAAGATGACGAGGAGGGAAGCTGTGGGGCTATCTAG
Gene >Ophun1|6485
ATGGCCTCCCCCCTAAGCCGCCTCCTCCTCCTCGGCGGCTATTCAGCCCTCGCCGCCGCCGGCGTGCCCCAACCG
CTCCCAAGCGAGAAGCTATGCCAGCACAGAGTCAAGAGCGGAGAATTCTGCTACCTCATCGCAGAAAACTACAAG
ACAACCGTCCCAGATCTCCGCAAATGGAACCCTCAGCTCGACGACGCCTGCAGCCTCAACCCCAAAGACATTCTC
AACGTCCCCTGCGTCGAGCCAGAGAAGCCAATGCCCAAGATGGACGGCCCTTGCACCAAGTTCTACACTGCTGCT
GAGGGAGACACCTGCTACTCCATCGCCACCTGCCAGGCGGTTGCGCCCCAGAACCTCATTGCTTGGAACCAGCTT
GATGAGGCTTGCACTCTCGAGGCGGGGCGGGAGTTGTGCGTCTCTCACTATGAGGAGCCTGCTGAGTGCAACAAG
TATCACCGCGTCAAGAAGGGAGATACGTGCTTTGATATTGCGCAGAGCATTGGCAAGGATTTGTCTTACTTGGTT
GAGCTGAACCCGGCGTTGCTGCAGCCGGTTTGCTCGCTTGATGTCGGTTACAAGGTCTGCATTGAGGCCGCGTCT
GAGTCGGTCATCGATGATGCTACTTTCACATCTCTGATCGATGCTCTTACTTCTGCGGCCGAAGTCTCTGGCTCT
TCGACCAGTACATGCACTTCCGCTGTCTTAGTCGATGCATCTTCAACTGCGGCTGTCGTCTCTGTTGCTTCAGTC
GATGCCTCTACTTCTTCGACTTCCGTCTCTGTTGTTTCCTCTGAGGTTTCCTCCAAGGCTTCAACTCCCTCGACC
GCCGTCATCTTCACCGCCCCGGCTTCCGTTTCCGCTGTTTCCTCCGAGGCTTCTACTGCCTCAACTGATGCTTCA
GCTCCCTCAACCGCCGTCTCAACCACCCCGGCCCTCGTCACATCCGTCTCGCAGCCTCTCTGGCCTCTGAACAGA
ACAACCACCACCATCGTCACAACCTTCATCACCAAGTCTCTCACCCGCTCGCCGTCTCTTCCCAGCTCGCTCTCC
CTTCCCAGCTCCTCGCCCCGCCCCCCCGTTACCCTGAACGTCAATATCTCGCAAGAGCTCAAGGCTCGCCTCAGG
CTGATCTGCGGCCGCTACGTCGGCAACTACACCAAGCCCGAGCCCATCCCGGACTCGGTCCTCTTGCCGCCCAGC
TCTCAGATAGAGGAAATGGTCAAGGAAGCGGCCAAGGTCAAGTCTGAGGGCCTTCAGGTTCCTGGTGGCAATGCG
GTGGAAGCCGTTGTCCCTTCGTCTGGTCCTCAGACTATCGTTCTGAACCAGCTGTTCAGAATCATCGTCTCTGCC
TCGGTTGACATTCGGAGCAGCGGCTGCGATACCGGTGCTTGCTCCCTTCAAGTCTCCTACAGCGCCAACGCCGGC
ATCAGGGCTCCGGCTGCAGTGGGCTCCGAGCTGGAGTTACCGCAGAGTGACGCCCCGGCCGCAGCTTCTGACGAG
ACCGAGGAGGTTGGGGAGGATGAGACGGAGGAAGATGACGAGGAGGGAAGCTGTGGGGCTATCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail