Fungal Genomics

at Utrecht University

General Properties

Protein IDOphun1|6482
Gene name
LocationContig_71:12751..14314
Strand-
Gene length (bp)1563
Transcript length (bp)1410
Coding sequence length (bp)1410
Protein length (aa) 470

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF03663 Glyco_hydro_76 Glycosyl hydrolase family 76 1.0E-131 30 402

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 1 405 2.0E-98
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 21 392 1.0E-97
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 14 389 5.0E-97
sp|Q5AD78|DCW1_CANAL Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCW1 PE=1 SV=1 1 402 3.0E-92
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 13 400 2.0E-89
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q6FLP9|DCW1_CANGA Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=DCW1 PE=3 SV=1 1 405 2.0E-98
sp|Q75DG6|DCW1_ASHGO Mannan endo-1,6-alpha-mannosidase DCW1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=DCW1 PE=3 SV=2 21 392 1.0E-97
sp|P36091|DCW1_YEAST Mannan endo-1,6-alpha-mannosidase DCW1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DCW1 PE=1 SV=1 14 389 5.0E-97
sp|Q5AD78|DCW1_CANAL Mannan endo-1,6-alpha-mannosidase DCW1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DCW1 PE=1 SV=1 1 402 3.0E-92
sp|Q05031|DFG5_YEAST Mannan endo-1,6-alpha-mannosidase DFG5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DFG5 PE=1 SV=1 13 400 2.0E-89
sp|O74556|YCZ2_SCHPO Putative mannan endo-1,6-alpha-mannosidase C970.02 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC970.02 PE=3 SV=1 1 397 5.0E-81
sp|Q9P6I3|YHG7_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.07c PE=3 SV=2 65 402 1.0E-79
sp|Q5ACZ2|DFG5_CANAL Mannan endo-1,6-alpha-mannosidase DFG5 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DFG5 PE=1 SV=1 6 404 7.0E-76
sp|Q9P6I4|YHG6_SCHPO Putative mannan endo-1,6-alpha-mannosidase C1198.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1198.06c PE=3 SV=1 21 395 6.0E-67
[Show less]

GO

(None)

Deeploc

Deeploc data not available for this genome

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

CAZyme category E-value Start End
GH76 5.1E-92 27 397

Secondary Metabolism

(None)

Expression data

No expression data available for this genome

Orthologs

Orthofinder run ID4
Orthogroup7
Change Orthofinder run
Species Protein ID
Ophiocordyceps australis 1348a (Ghana) OphauG2|851
Ophiocordyceps australis 1348a (Ghana) OphauG2|5443
Ophiocordyceps australis 1348a (Ghana) OphauG2|4774
Ophiocordyceps australis 1348a (Ghana) OphauG2|4766
Ophiocordyceps australis 1348a (Ghana) OphauG2|1899
Ophiocordyceps australis map64 (Brazil) OphauB2|7760
Ophiocordyceps australis map64 (Brazil) OphauB2|7513
Ophiocordyceps australis map64 (Brazil) OphauB2|3901
Ophiocordyceps australis map64 (Brazil) OphauB2|3420
Ophiocordyceps australis map64 (Brazil) OphauB2|2008
Ophiocordyceps camponoti-floridani Ophcf2|00987
Ophiocordyceps camponoti-floridani Ophcf2|06598
Ophiocordyceps camponoti-floridani Ophcf2|06757
Ophiocordyceps camponoti-floridani Ophcf2|06881
Ophiocordyceps camponoti-floridani Ophcf2|03911
Ophiocordyceps camponoti-floridani Ophcf2|02543
Ophiocordyceps camponoti-rufipedis Ophun1|305
Ophiocordyceps camponoti-rufipedis Ophun1|3601
Ophiocordyceps camponoti-rufipedis Ophun1|4119
Ophiocordyceps camponoti-rufipedis Ophun1|5000
Ophiocordyceps camponoti-rufipedis Ophun1|6482 (this protein)
Ophiocordyceps camponoti-rufipedis Ophun1|5419
Ophiocordyceps kimflemingae Ophio5|3601
Ophiocordyceps kimflemingae Ophio5|3900
Ophiocordyceps kimflemingae Ophio5|5653
Ophiocordyceps kimflemingae Ophio5|7279
Ophiocordyceps kimflemingae Ophio5|8067
Ophiocordyceps kimflemingae Ophio5|971
Ophiocordyceps subramaniannii Hirsu2|9651
Ophiocordyceps subramaniannii Hirsu2|923
Ophiocordyceps subramaniannii Hirsu2|6764
Ophiocordyceps subramaniannii Hirsu2|3862
Ophiocordyceps subramaniannii Hirsu2|3585
Ophiocordyceps subramaniannii Hirsu2|266
Ophiocordyceps subramaniannii Hirsu2|2507
Ophiocordyceps subramaniannii Hirsu2|10632

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >Ophun1|6482
MKFVKSVRAAAAFTGFFAPRDLDTGNHTSVRLAASTLAHDTMVYYSGNTTEAKPVDVGNVPKPYYWWVAGALWGA
MLDYYHMTGDASYNDVVLQALTAPTNLGRGLDFMPAEHASEEGNDDLFFWGSAVMSAAERNFPQPDDKLPSWLDM
ASNVFNSLISRWHTADCGGGMLWQIYASNPNGMTYKNSVSNGGLFQLAARLARATGNQTYLHWAEQTWNWTATRG
LIDNNNFHVYDGVDTRTKCAEVNHQSFTYTSGIFLYGAAVLANHTRDPVWAERASRLLDGAGWFFKPDGPGKGIL
FEAACEEVDKCNYDMVTFKGYLARYMWQSTVMQPALRQRVEDLLVPSARAAASTCTGGSDGRLCGMRWYQGSFDN
KAGLGSQMCALETIQGLLVDSSRPPLSGKDIRRVRDCPWRHQGPKVRSLPVDQRPSSSDVGVVRRGRYMLNSAAR
RGRTAPAALGSSRGAERDA*
Coding >Ophun1|6482
ATGAAGTTCGTCAAGAGCGTGAGGGCGGCGGCGGCCTTTACTGGCTTCTTCGCGCCCAGGGATCTGGATACGGGG
AATCACACCTCGGTTCGGCTGGCGGCTTCGACGCTCGCGCACGACACCATGGTCTACTACTCGGGCAACACCACC
GAGGCCAAGCCTGTGGACGTGGGCAACGTGCCCAAGCCGTACTACTGGTGGGTGGCGGGCGCTCTCTGGGGCGCC
ATGCTCGATTACTACCACATGACGGGCGACGCCAGCTACAATGACGTGGTGCTGCAGGCTCTGACGGCGCCGACG
AACCTCGGTCGCGGCCTCGACTTTATGCCGGCCGAGCACGCGTCCGAGGAGGGCAACGATGACCTCTTCTTCTGG
GGCTCGGCTGTCATGTCGGCTGCTGAGCGCAACTTTCCCCAGCCCGACGACAAGCTGCCCTCGTGGCTCGACATG
GCCAGCAACGTCTTCAACTCGCTCATCAGCCGCTGGCACACGGCTGATTGTGGAGGCGGCATGCTGTGGCAGATC
TACGCCTCCAACCCCAACGGCATGACGTACAAGAACTCGGTCAGCAATGGTGGGCTCTTTCAGCTGGCTGCTCGT
TTGGCTCGGGCCACGGGCAACCAGACGTATCTGCATTGGGCTGAGCAGACCTGGAACTGGACCGCTACACGGGGG
CTGATTGACAACAACAACTTCCATGTCTATGATGGTGTCGATACTCGCACCAAGTGCGCCGAGGTCAACCACCAG
TCCTTCACTTACACCAGCGGCATCTTCCTCTACGGCGCTGCCGTTCTCGCCAACCACACGCGCGATCCCGTCTGG
GCAGAGAGGGCATCGCGTCTCCTCGACGGCGCGGGCTGGTTCTTCAAGCCTGATGGTCCGGGCAAAGGCATCTTG
TTCGAGGCCGCGTGCGAGGAGGTCGACAAGTGCAACTACGACATGGTGACGTTCAAGGGCTACCTGGCGCGCTAC
ATGTGGCAGTCGACGGTGATGCAGCCAGCGCTTCGTCAACGCGTCGAGGACCTCCTCGTGCCCTCTGCCCGTGCC
GCCGCCTCGACATGCACGGGCGGAAGCGACGGTCGTCTCTGCGGCATGCGCTGGTACCAAGGCTCCTTCGACAAC
AAAGCCGGCCTCGGCTCCCAGATGTGCGCGCTCGAGACGATCCAGGGCCTCCTCGTCGACTCGAGTCGTCCTCCG
CTATCGGGCAAGGACATCCGCCGCGTCCGGGACTGCCCGTGGCGCCATCAGGGGCCAAAGGTCAGGAGCCTCCCT
GTTGACCAGAGGCCGTCGTCGTCGGACGTGGGCGTGGTCCGTCGCGGGCGCTATATGCTGAATAGCGCTGCGCGG
CGTGGCCGCACTGCGCCGGCTGCTTTAGGATCCTCCCGAGGCGCCGAAAGAGACGCCTGA
Transcript >Ophun1|6482
ATGAAGTTCGTCAAGAGCGTGAGGGCGGCGGCGGCCTTTACTGGCTTCTTCGCGCCCAGGGATCTGGATACGGGG
AATCACACCTCGGTTCGGCTGGCGGCTTCGACGCTCGCGCACGACACCATGGTCTACTACTCGGGCAACACCACC
GAGGCCAAGCCTGTGGACGTGGGCAACGTGCCCAAGCCGTACTACTGGTGGGTGGCGGGCGCTCTCTGGGGCGCC
ATGCTCGATTACTACCACATGACGGGCGACGCCAGCTACAATGACGTGGTGCTGCAGGCTCTGACGGCGCCGACG
AACCTCGGTCGCGGCCTCGACTTTATGCCGGCCGAGCACGCGTCCGAGGAGGGCAACGATGACCTCTTCTTCTGG
GGCTCGGCTGTCATGTCGGCTGCTGAGCGCAACTTTCCCCAGCCCGACGACAAGCTGCCCTCGTGGCTCGACATG
GCCAGCAACGTCTTCAACTCGCTCATCAGCCGCTGGCACACGGCTGATTGTGGAGGCGGCATGCTGTGGCAGATC
TACGCCTCCAACCCCAACGGCATGACGTACAAGAACTCGGTCAGCAATGGTGGGCTCTTTCAGCTGGCTGCTCGT
TTGGCTCGGGCCACGGGCAACCAGACGTATCTGCATTGGGCTGAGCAGACCTGGAACTGGACCGCTACACGGGGG
CTGATTGACAACAACAACTTCCATGTCTATGATGGTGTCGATACTCGCACCAAGTGCGCCGAGGTCAACCACCAG
TCCTTCACTTACACCAGCGGCATCTTCCTCTACGGCGCTGCCGTTCTCGCCAACCACACGCGCGATCCCGTCTGG
GCAGAGAGGGCATCGCGTCTCCTCGACGGCGCGGGCTGGTTCTTCAAGCCTGATGGTCCGGGCAAAGGCATCTTG
TTCGAGGCCGCGTGCGAGGAGGTCGACAAGTGCAACTACGACATGGTGACGTTCAAGGGCTACCTGGCGCGCTAC
ATGTGGCAGTCGACGGTGATGCAGCCAGCGCTTCGTCAACGCGTCGAGGACCTCCTCGTGCCCTCTGCCCGTGCC
GCCGCCTCGACATGCACGGGCGGAAGCGACGGTCGTCTCTGCGGCATGCGCTGGTACCAAGGCTCCTTCGACAAC
AAAGCCGGCCTCGGCTCCCAGATGTGCGCGCTCGAGACGATCCAGGGCCTCCTCGTCGACTCGAGTCGTCCTCCG
CTATCGGGCAAGGACATCCGCCGCGTCCGGGACTGCCCGTGGCGCCATCAGGGGCCAAAGGTCAGGAGCCTCCCT
GTTGACCAGAGGCCGTCGTCGTCGGACGTGGGCGTGGTCCGTCGCGGGCGCTATATGCTGAATAGCGCTGCGCGG
CGTGGCCGCACTGCGCCGGCTGCTTTAGGATCCTCCCGAGGCGCCGAAAGAGACGCCTGA
Gene >Ophun1|6482
ATGAAGTTCGTCAAGAGCGTGAGGGCGGCGGCGGCCTTTACTGGCTTCTTCGCGCCCAGGGATCTGGATACGGGG
AATCACAGTGAGTTGTGGCGTCCCAGGGGGAGAGAGAGAGAGAGAGAGAGAAGGAGAGAGAAGGAGGGTCATGGG
CTGACTGTCTCCATCACAGCCTCGGTTCGGCTGGCGGCTTCGACGCTCGCGCACGACACCATGGTCTACTACTCG
GGCAACACCACCGAGGCCAAGCCTGTGGTGAGTCTCGAGAGCCAGCTCCAAGATGAGCAGACTCGACGACTGACA
GGAGACCTTTCCTCGCAGGACGTGGGCAACGTGCCCAAGCCGTACTACTGGTGGGTGGCGGGCGCTCTCTGGGGC
GCCATGCTCGATTACTACCACATGACGGGCGACGCCAGCTACAATGACGTGGTGCTGCAGGCTCTGACGGCGCCG
ACGAACCTCGGTCGCGGCCTCGACTTTATGCCGGCCGAGCACGCGTCCGAGGAGGGCAACGATGACCTCTTCTTC
TGGGGCTCGGCTGTCATGTCGGCTGCTGAGCGCAACTTTCCCCAGCCCGACGACAAGCTGCCCTCGTGGCTCGAC
ATGGCCAGCAACGTCTTCAACTCGCTCATCAGCCGCTGGCACACGGCTGATTGTGGAGGCGGCATGCTGTGGCAG
ATCTACGCCTCCAACCCCAACGGCATGACGTACAAGAACTCGGTCAGCAATGGTGGGCTCTTTCAGCTGGCTGCT
CGTTTGGCTCGGGCCACGGGCAACCAGACGTATCTGCATTGGGCTGAGCAGACCTGGAACTGGACCGCTACACGG
GGGCTGATTGACAACAACAACTTCCATGTCTATGATGGTGTCGATACTCGCACCAAGTGCGCCGAGGTCAACCAC
CAGTCCTTCACTTACACCAGCGGCATCTTCCTCTACGGCGCTGCCGTTCTCGCCAACCACACGCGCGATCCCGTC
TGGGCAGAGAGGGCATCGCGTCTCCTCGACGGCGCGGGCTGGTTCTTCAAGCCTGATGGTCCGGGCAAAGGCATC
TTGTTCGAGGCCGCGTGCGAGGAGGTCGACAAGTGCAACTACGACATGGTGACGTTCAAGGGCTACCTGGCGCGC
TACATGTGGCAGTCGACGGTGATGCAGCCAGCGCTTCGTCAACGCGTCGAGGACCTCCTCGTGCCCTCTGCCCGT
GCCGCCGCCTCGACATGCACGGGCGGAAGCGACGGTCGTCTCTGCGGCATGCGCTGGTACCAAGGCTCCTTCGAC
AACAAAGCCGGCCTCGGCTCCCAGATGTGCGCGCTCGAGACGATCCAGGGCCTCCTCGTCGACTCGAGTCGTCCT
CCGCTATCGGGCAAGGACATCCGCCGCGTCCGGGACTGCCCGTGGCGCCATCAGGGGCCAAAGGTCAGGAGCCTC
CCTGTTGACCAGAGGCCGTCGTCGTCGGACGTGGGCGTGGTCCGTCGCGGGCGCTATATGCTGAATAGCGCTGCG
CGGCGTGGCCGCACTGCGCCGGCTGCTTTAGGATCCTCCCGAGGCGCCGAAAGAGACGCCTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail